G-protein coupled receptor 15 (GPR15) Recombinant Protein | GPR15 recombinant protein
Recombinant Chlorocebus aethiops G-protein coupled receptor 15 (GPR15)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor 15 (GPR15); Recombinant Chlorocebus aethiops G-protein coupled receptor 15 (GPR15); Recombinant G-protein coupled receptor 15 (GPR15); G-protein coupled receptor 15; Brother of Bonzo; BoB; GPR15 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-360
Sequence
MDPEETSVYLDYYYATSPNPDIRETHSHVPYTSVFLPVFYIAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVFLLTCMSVDRYLAIVCPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPLKLIWSLVALIFTFFVPLLSIVTCYCRIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTSKLLAIVSGLQQERYFPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFTRRRKRSVSL
Sequence Length
360
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
40,774 Da
NCBI Official Full Name
G-protein coupled receptor 15
UniProt Protein Name
G-protein coupled receptor 15
Protein Family
UniProt Gene Name
GPR15
UniProt Synonym Gene Names
BoB
UniProt Entry Name
GPR15_CHLAE
Uniprot Description
Function: Probable chemokine receptor. SIV-1 coreceptor.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The G-protein coupled receptor 15 (GPR15) gpr15 (Catalog #AAA1193472) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-360. The amino acid sequence is listed below: MDPEETSVYL DYYYATSPNP DIRETHSHVP YTSVFLPVFY IAVFLTGVLG NLVLMGALHF KPGSRRLIDI FIINLAASDF IFLVTLPLWV DKEASLGLWR TGSFLCKGSS YMISVNMHCS VFLLTCMSVD RYLAIVCPVV SRKFRRTDCA YVVCASIWFI SCLLGLPTLL SRELTLIDDK PYCAEKKATP LKLIWSLVAL IFTFFVPLLS IVTCYCRIAR KLCAHYQQSG KHNKKLKKSI KIIFIVVAAF LVSWLPFNTS KLLAIVSGLQ QERYFPSAIL QLGMEVSGPL AFANSCVNPF IYYIFDSYIR RAIVHCLCPC LKNYDFGSST ETSDSHLTKA LSTFIHAEDF TRRRKRSVSL. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor 15 (GPR15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
