Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Mucin-16 (MUC16) Active Protein | MUC16 active protein

Recombinant Human Mucin-16 (MUC16), partial (Active)

Gene Names
MUC16; CA125
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucin-16 (MUC16); Recombinant Human Mucin-16 (MUC16); partial (Active); MUC16 active protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
12660-12923aa, Partial
Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10ug/mL can bind MSLN , the EC50 is 460.7-662.2ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Activity
Product Categories/Family for MUC16 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
2,353,428 Da
NCBI Official Full Name
mucin-16
NCBI Official Synonym Full Names
mucin 16, cell surface associated
NCBI Official Symbol
MUC16
NCBI Official Synonym Symbols
CA125
NCBI Protein Information
mucin-16; CA-125; MUC-16; CA125 ovarian cancer antigen; ovarian carcinoma antigen CA125; ovarian cancer-related tumor marker CA125
UniProt Protein Name
Mucin-16
Protein Family
UniProt Gene Name
MUC16
UniProt Synonym Gene Names
CA125; MUC-16; CA-125
UniProt Entry Name
MUC16_HUMAN

Uniprot Description

MUC16: Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Protein type: Membrane protein, integral; Cell adhesion; Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: extracellular space; extrinsic to membrane; Golgi lumen; integral to membrane; plasma membrane; vesicle

Molecular Function: protein binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; cell adhesion; post-translational protein modification

Research Articles on MUC16

Similar Products

Product Notes

The MUC16 muc16 (Catalog #AAA9018428) is an Active Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 12660-12923aa, Partial. The amino acid sequence is listed below: GFTHWIPVPT SSTPGTSTVD LGSGTPSSLP SPTTAGPLLV PFTLNFTITN LKYEEDMHCP GSRKFNTTER VLQSLLGPMF KNTSVGPLYS GCRLTLLRSE KDGAATGVDA ICTHRLDPKS PGVDREQLYW ELSQLTNGIK ELGPYTLDRN SLYVNGFTHQ TSAPNTSTPG TSTVDLGTSG TPSSLPSPTS AGPLLVPFTL NFTITNLQYE EDMHHPGSRK FNTTERVLQG LLGPMFKNTS VGLLYSGCRL TLLRPEKNGA ATGM. It is sometimes possible for the material contained within the vial of "Mucin-16 (MUC16), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.