Putative cryptic C4-dicarboxylate transporter DcuD (dcuD) Recombinant Protein | dcuD recombinant protein
Recombinant Escherichia coli Putative cryptic C4-dicarboxylate transporter DcuD (dcuD), partial
Gene Names
dcuD; ECK3216; JW3196; yhcL
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative cryptic C4-dicarboxylate transporter DcuD (dcuD); Recombinant Escherichia coli Putative cryptic C4-dicarboxylate transporter DcuD (dcuD); partial; dcuD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-455
Sequence
MFGIIISVIVLITMGYLILKNYKPQVVLAAAGIFLMMCGVWLGFGGVLDPTKSSGYLIVDIYNEILRMLSNRIAGLGLSIMAVGGYARYMERIGASRAMVSLLSRPLKLIRSPYIILSATYVIGQIMAQFITSASGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIFAAQVAGMKIATYFFHYQLPVASCVIISVAISHFFVQRAFDKKDKNINHEQAEQKALDNVPPLYYAILPVMPLILMLGSLFLAHVGLMQSELHLVVVMLLSLTVTMFVEFFRKHNLRETMDDVQAFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALVIAICAIVMGSGNAPFMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVTSGIAGVSPFAVVKRTAIPMAVGFVVNMIATITLFY
Sequence Length
455
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,831 Da
NCBI Official Full Name
putative transporter
NCBI Official Symbol
dcuD
NCBI Official Synonym Symbols
ECK3216; JW3196; yhcL
NCBI Protein Information
putative transporter
UniProt Protein Name
Putative cryptic C4-dicarboxylate transporter DcuD
Protein Family
UniProt Gene Name
dcuD
UniProt Synonym Gene Names
yhcL
NCBI Description
IT (Ion Transporter) superfamily (Prakash, 2003). [More information is available at EcoGene: EG12818]. The DcuD protein is an uncharacterized member of the DcuC family of anaerobic dicarboxylate transporters . dcuD is either not expressed or is expressed under conditions unrelated to carboxylate metabolism. [More information is available at EcoCyc: G7679].
Uniprot Description
May have a role in the transport of dicarboxylates from the periplasm across the inner membrane. Seems not to be essential for growth. It is likely to be a cryptic gene, as no or low expression has been found under a number of growth conditions and when tested with a large number of potential substrates.
Similar Products
Product Notes
The dcuD dcud (Catalog #AAA1192827) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-455. The amino acid sequence is listed below: MFGIIISVIV LITMGYLILK NYKPQVVLAA AGIFLMMCGV WLGFGGVLDP TKSSGYLIVD IYNEILRMLS NRIAGLGLSI MAVGGYARYM ERIGASRAMV SLLSRPLKLI RSPYIILSAT YVIGQIMAQF ITSASGLGML LMVTLFPTLV SLGVSRLSAV AVIATTMSIE WGILETNSIF AAQVAGMKIA TYFFHYQLPV ASCVIISVAI SHFFVQRAFD KKDKNINHEQ AEQKALDNVP PLYYAILPVM PLILMLGSLF LAHVGLMQSE LHLVVVMLLS LTVTMFVEFF RKHNLRETMD DVQAFFDGMG TQFANVVTLV VAGEIFAKGL TTIGTVDAVI RGAEHSGLGG IGVMIIMALV IAICAIVMGS GNAPFMSFAS LIPNIAAGLH VPAVVMIMPM HFATTLARAV SPITAVVVVT SGIAGVSPFA VVKRTAIPMA VGFVVNMIAT ITLFY. It is sometimes possible for the material contained within the vial of "Putative cryptic C4-dicarboxylate transporter DcuD (dcuD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
