Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Virion egress protein BFLF2 (BFLF2) Recombinant Protein | BFLF2 recombinant protein

Recombinant Epstein-Barr virus Virion egress protein BFLF2 (BFLF2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Virion egress protein BFLF2 (BFLF2); Recombinant Epstein-Barr virus Virion egress protein BFLF2 (BFLF2); BFLF2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-318, Full length protein
Sequence
MAPVTPDAVNARQQRPADPALRRLMHPHHRNYTASKASAHSVKSVSRCGKSRSELGRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQVHVPQEFSSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPIFSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDTVYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILENKQ
Sequence Length
318
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,361 Da
NCBI Official Full Name
BFLF2
NCBI Official Symbol
HHV4tp2_gp08
NCBI Protein Information
BFLF2; ORF69
UniProt Protein Name
Nuclear egress protein 1
UniProt Gene Name
NEC1

Uniprot Description

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Similar Products

Product Notes

The BFLF2 nec1 (Catalog #AAA1187986) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-318, Full length protein. The amino acid sequence is listed below: MAPVTPDAVN ARQQRPADPA LRRLMHPHHR NYTASKASAH SVKSVSRCGK SRSELGRMER VGSVARSICS RHTRHGVDRS HFSLRDFFRG ISANFELGKD FLREMNTPIH VSEAVFLPLS LCTLSPGRCL RLSPFGHSLT LGSHCEICIN RSQVHVPQEF SSTQLSFFNN VHKIIPNKTF YVSLLSSSPS AVKAGLSQPS LLYAYLVTGH FCGTICPIFS TNGKGRLIMH LLLQGTSLHI PETCLKLLCE NIGPTYELAV DLVGDAFCIK VSPRDTVYEK AVNVDEDAIY EAIKDLECGD ELRLQIINYT QLILENKQ. It is sometimes possible for the material contained within the vial of "Virion egress protein BFLF2 (BFLF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.