Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HK1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit HK1 Polyclonal Antibody | anti-HK1 antibody

HK1 antibody - middle region

Gene Names
HK1; HK; HKD; HKI; HXK1; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; hexokinase
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HK1; Polyclonal Antibody; HK1 antibody - middle region; anti-HK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR
Sequence Length
921
Applicable Applications for anti-HK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 77%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HK1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-HK1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-HK1 antibody
This is a rabbit polyclonal antibody against HK1. It was validated on Western Blot

Target Description: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein.
Product Categories/Family for anti-HK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
hexokinase-1 isoform HKI-ta/tb
NCBI Official Synonym Full Names
hexokinase 1
NCBI Official Symbol
HK1
NCBI Official Synonym Symbols
HK; HKD; HKI; HXK1; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; hexokinase
NCBI Protein Information
hexokinase-1
UniProt Protein Name
Hexokinase-1
Protein Family
UniProt Gene Name
HK1
UniProt Synonym Gene Names
HK I
UniProt Entry Name
HXK1_HUMAN

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific. [provided by RefSeq, Apr 2016]

Uniprot Description

HK1: a glycolytic enzyme that catalyzes the reaction ATP + D-hexose = ADP + D-hexose 6-phosphate. The first and rate-limiting step in glycosis, a pathway that produces energy in the form of ATP from glucose. An allosteric enzyme inhibited by its product glucose-6-phosphate (Glc-6-P). HK-2 and its mitochondrial receptor (VDAC) play the most pivotal and direct roles in the ""Warburg effect"". Acts as a ""glucose sensor"" by trapping glucose inside the cell by catalyzing its phosphorylation to produce Glc-6-P. In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase). Four human isoforms are produced by alternative splicing and alternative initiation. Isoform HK1 is markedly elevated in rapidly growing tumor cells exhibiting high glucose catabolic rates. HK1 is present in most tissues but is especially prominent in brain and kidney. Isoform HK1-SC is is an integral membrane protein detected in round spermatids, condensing spermatids and mature sperm where it is found in the head membranes, mitochondria of the midpiece and the fibrous sheath of the flagellum. Isoform HK1-SA is first expressed during meiosis and continues to be present in postmeiotic germ cells while isoform HK1-SB is present only in postmeiotic germ cells.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Kinase, other; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Mitochondrial; Carbohydrate Metabolism - galactose; EC 2.7.1.1; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: mitochondrial outer membrane; mitochondrion; cytosol; lipid raft

Molecular Function: hexokinase activity; protein binding; mannokinase activity; fructokinase activity; glucokinase activity; ATP binding

Biological Process: hexose metabolic process; glycolysis; hexose transport; carbohydrate metabolic process; glucose 6-phosphate metabolic process; carbohydrate phosphorylation; cell glucose homeostasis; pathogenesis; glucose transport; transmembrane transport

Disease: Hemolytic Anemia, Nonspherocytic, Due To Hexokinase Deficiency; Neuropathy, Hereditary Motor And Sensory, Russe Type

Research Articles on HK1

Similar Products

Product Notes

The HK1 hk1 (Catalog #AAA3215061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HK1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HK1 hk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILVKMAKEGL LFEGRITPEL LTRGKFNTSD VSAIEKNKEG LHNAKEILTR. It is sometimes possible for the material contained within the vial of "HK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.