G-protein coupled receptor 183-A (gpr183a) Recombinant Protein | gpr183 recombinant protein
Recombinant Danio rerio G-protein coupled receptor 183-A (gpr183a)
Gene Names
gpr183; ebi2; gpr183a; zgc:165579
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor 183-A (gpr183a); Recombinant Danio rerio G-protein coupled receptor 183-A (gpr183a); Recombinant G-protein coupled receptor 183-A (gpr183a); G-protein coupled receptor 183-A; gpr183 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-368
Sequence
METTSANFTQNDSNVCTNLYNHRGWAQYFLPAMYSLICIVGLLGNVLALHVIWPNLKKINSTTLYSANLVVSDILFSLALPLRVVYYARGFDWPMGEGLCKAVALLFYINMYAGVNFMTCLSVDRFIAVVLPLRFSRFRKVQKVRYICGVVWVVVLMQTLPLLSMPMTNIEQSGHITCMEYPNFEKIDNLPVMLIGAVVLGFGIPVITILVCYTALCLKLRHLAKSNKLTEKSGRSSKAIGVICTVILVFVVCYSPYHVDLLQYMIKKLRYDPDCSELHKFQISLHITVCFMNLNSCLDPFIYFFACKGYKKKVLKLLKKQVSMSFSSVVRTSPEGSSKDVFGNDKIQMNSRSFQKERSSVLLNSLEQ
Sequence Length
368
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,705 Da
NCBI Official Full Name
G-protein coupled receptor 183-A
NCBI Official Synonym Full Names
G protein-coupled receptor 183
NCBI Official Symbol
gpr183
NCBI Official Synonym Symbols
ebi2; gpr183a; zgc:165579
NCBI Protein Information
G-protein coupled receptor 183-A; Epstein-Barr virus induced gene 2
UniProt Protein Name
G-protein coupled receptor 183-A
Protein Family
UniProt Gene Name
gpr183a
UniProt Synonym Gene Names
gpr183
UniProt Entry Name
GP83A_DANRE
Uniprot Description
Function: Probable receptor for oxysterols that plays a central role during humoral immunity. Promotes activated B-cell localization in the outer follicle and interfollicular regions
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The gpr183 gpr183a (Catalog #AAA1187766) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368. The amino acid sequence is listed below: METTSANFTQ NDSNVCTNLY NHRGWAQYFL PAMYSLICIV GLLGNVLALH VIWPNLKKIN STTLYSANLV VSDILFSLAL PLRVVYYARG FDWPMGEGLC KAVALLFYIN MYAGVNFMTC LSVDRFIAVV LPLRFSRFRK VQKVRYICGV VWVVVLMQTL PLLSMPMTNI EQSGHITCME YPNFEKIDNL PVMLIGAVVL GFGIPVITIL VCYTALCLKL RHLAKSNKLT EKSGRSSKAI GVICTVILVF VVCYSPYHVD LLQYMIKKLR YDPDCSELHK FQISLHITVC FMNLNSCLDP FIYFFACKGY KKKVLKLLKK QVSMSFSSVV RTSPEGSSKD VFGNDKIQMN SRSFQKERSS VLLNSLEQ. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor 183-A (gpr183a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
