3-hydroxyacyl-CoA dehydratase 4 (Ptplad2) Recombinant Protein | Ptplad2 recombinant protein
Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 4 (Ptplad2)
Gene Names
Ptplad2; HACD4; 4933428I03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydratase 4 (Ptplad2); Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 4 (Ptplad2); Ptplad2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-232
Sequence
MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV
Sequence Length
232
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Ptplad2 recombinant protein
Ptplad2; hacd4
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,235 Da
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4
NCBI Official Synonym Full Names
protein tyrosine phosphatase-like A domain containing 2
NCBI Official Symbol
Ptplad2
NCBI Official Synonym Symbols
HACD4; 4933428I03Rik
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4; 3-hydroxyacyl-CoA dehydratase 4; protein tyrosine phosphatase-like protein PTPLAD2; protein-tyrosine phosphatase-like A domain-containing protein 2
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4
UniProt Gene Name
Ptplad2
UniProt Synonym Gene Names
hacd4; HACD4
UniProt Entry Name
HACD4_MOUSE
Uniprot Description
PTPLAD2: Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. Belongs to the very long-chain fatty acids dehydratase HACD family.
Protein type: Membrane protein, integral; EC 4.2.1.134; Membrane protein, multi-pass
Cellular Component: membrane; endoplasmic reticulum; integral to membrane
Molecular Function: enzyme binding; lyase activity; 3-hydroxyacyl-CoA dehydratase activity
Biological Process: very-long-chain fatty acid biosynthetic process; fatty acid elongation; lipid metabolic process; fatty acid metabolic process; fatty acid biosynthetic process
Similar Products
Product Notes
The Ptplad2 ptplad2 (Catalog #AAA1187467) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-232. The amino acid sequence is listed below: MGPSVLPAWL QPRYRKNVYL FIYYLIQFCG HSWILANMTV RFFSFGKDSM ADTFYAIGLV MRVCQSISLL ELLHIYIGIE SNQLFPRFLQ LTERVIILFG VITSQEEVQE KCVVCVLFIL WNLLDMVRYT YSMLSVIGTS YAALTWLSQT LWMPIYPLCV LAEAFTIYQS LPYFESFGTN STVLPFDLST CFPYVLKLYL MMLFIGMYFT YSHLYTERKD FLRVFSVKQK NV. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydratase 4 (Ptplad2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
