Phosphoglycerol transferase I (mdoB) Recombinant Protein | SARI_03038 recombinant protein
Recombinant Salmonella arizonae Phosphoglycerol transferase I (mdoB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphoglycerol transferase I (mdoB); Recombinant Salmonella arizonae Phosphoglycerol transferase I (mdoB); Recombinant Phosphoglycerol transferase I (mdoB); Phosphoglycerol transferase I EC= 2.7.8.20; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase; SARI_03038 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-763
Sequence
MSELLSVALFLASVLVYAWKAGRNTWWFAATLTVLGLFVILNITRYASDYFTGDGINDAVLYTLTNSLTGAGVGKYILPGIGIVLALVGVFGALGWILRRRRHHPHHVGYSLLALLLALGSVDASPAFRQITELVKSQTRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDNDAFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFFPQNICLGDILKNAGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVTDPSYRNDWGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDSKPNQSFSAVSCSQENIARFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRGDKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPDIVRLWNFPKEMKAFTIDQDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLADFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQTVQHVDKTQWKGKTAFKDTVIDMQRYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPETWGRWSNAQLGDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTTTLHFNNPTDASTLVIAPPVPVSTNEGNILGHSPRKLGIGMVEIKVVNAES
Sequence Length
763
Species
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,137 Da
NCBI Official Full Name
phosphoglycerol transferase I
NCBI Official Symbol
SARI_03038
NCBI Protein Information
phosphoglycerol transferase I
UniProt Protein Name
Phosphoglycerol transferase I
UniProt Gene Name
mdoB
UniProt Synonym Gene Names
opgB
UniProt Entry Name
OPGB_SALAR
Uniprot Description
Function: Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones
By similarity. HAMAP-Rule MF_01070
Catalytic activity: Phosphatidylglycerol + membrane-derived-oligosaccharide D-glucose = 1,2-diacyl-sn-glycerol + membrane-derived-oligosaccharide 6-(glycerophospho)-D-glucose. HAMAP-Rule MF_01070
Pathway: Glycan metabolism; osmoregulated periplasmic glucan (OPG) biosynthesis. HAMAP-Rule MF_01070
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01070.
Sequence similarities: Belongs to the OpgB family.
Similar Products
Product Notes
The SARI_03038 mdob (Catalog #AAA1186243) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-763. The amino acid sequence is listed below: MSELLSVALF LASVLVYAWK AGRNTWWFAA TLTVLGLFVI LNITRYASDY FTGDGINDAV LYTLTNSLTG AGVGKYILPG IGIVLALVGV FGALGWILRR RRHHPHHVGY SLLALLLALG SVDASPAFRQ ITELVKSQTR DGDPDFAVYY KEPAKTIPNP KLNLVYIYGE SLERTYFDND AFPNLTPELG ALKNEGLDFS HTMQLPGTDY TIAGMVASQC GIPLFAPFEG NASASVSSFF PQNICLGDIL KNAGYQNYFV QGANLRFAGK DVFLKSHGFD HLYGAEELKT VVTDPSYRND WGFYDDTVLD EAWKKFEALS RSGQRFSLFT LTVDTHHPDG FISRTCNRKR YDYDSKPNQS FSAVSCSQEN IARFINKIKA SPWFKDTVIV VSSDHLAMNN TAWKYLNKQD RNNLFFILRG DKPQQETLAV KRNTMDNGAT VLDILGGDNF IGLGRSSLSG QSLSEVFLNV KEKVLAMKPD IVRLWNFPKE MKAFTIDQDK NMIAFSGSHF RLPLLLRVSD KRVEPLPESE YSAPLRFQLA DFAPRDNFVW VDRCYKMAQL WAPELALSTD WCVSQGQLGG QQTVQHVDKT QWKGKTAFKD TVIDMQRYKG NVDTLKIVDN DIRYKADSFI FNVAGAPEEV KQFSGISRPE TWGRWSNAQL GDEVKIEYKA PLPKKFDLVI TAKAFGDNAN RPIPVRVGNE EQTLVLGHDV STTTLHFNNP TDASTLVIAP PVPVSTNEGN ILGHSPRKLG IGMVEIKVVN AES. It is sometimes possible for the material contained within the vial of "Phosphoglycerol transferase I (mdoB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
