General amino-acid permease GAP1 (GAP1) Recombinant Protein | GAP1 recombinant protein
Recombinant Saccharomyces cerevisiae General amino-acid permease GAP1 (GAP1) , partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
General amino-acid permease GAP1 (GAP1); Recombinant Saccharomyces cerevisiae General amino-acid permease GAP1 (GAP1); partial; GAP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-602
Sequence
MSNTSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC
Sequence Length
602
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,656 Da
NCBI Official Full Name
amino acid permease GAP1
NCBI Official Symbol
GAP1
NCBI Protein Information
amino acid permease GAP1
UniProt Protein Name
General amino-acid permease GAP1
Protein Family
UniProt Gene Name
GAP1
Uniprot Description
General amino-acid permease involved in the uptake of all the naturally occurring L-amino-acids, related compounds such as ornithine and citrulline, some D-amino acids, toxic amino acid analogs such as azetidine-2-carboxylate, and the polyamines putrescine and spermidine (PubMed:5474888, PubMed:10467005, PubMed:10373490, PubMed:10953083, PubMed:14968425, PubMed:15707981). Senses its transport substrates to set an appropriate level of transporter activity at the cell surface (PubMed:21471002). Required for FLO11 expression and invasive growth (PubMed:22844449).
Research Articles on GAP1
Similar Products
Product Notes
The GAP1 gap1 (Catalog #AAA1179403) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-602. The amino acid sequence is listed below: MSNTSSYEKN NPDNLKHNGI TIDSEFLTQE PITIPSNGSA VSIDETGSGS KWQDFKDSFK RVKPIEVDPN LSEAEKVAII TAQTPLKHHL KNRHLQMIAI GGAIGTGLLV GSGTALRTGG PASLLIGWGS TGTMIYAMVM ALGELAVIFP ISGGFTTYAT RFIDESFGYA NNFNYMLQWL VVLPLEIVSA SITVNFWGTD PKYRDGFVAL FWLAIVIINM FGVKGYGEAE FVFSFIKVIT VVGFIILGII LNCGGGPTGG YIGGKYWHDP GAFAGDTPGA KFKGVCSVFV TAAFSFAGSE LVGLAASESV EPRKSVPKAA KQVFWRITLF YILSLLMIGL LVPYNDKSLI GASSVDAAAS PFVIAIKTHG IKGLPSVVNV VILIAVLSVG NSAIYACSRT MVALAEQRFL PEIFSYVDRK GRPLVGIAVT SAFGLIAFVA ASKKEGEVFN WLLALSGLSS LFTWGGICIC HIRFRKALAA QGRGLDELSF KSPTGVWGSY WGLFMVIIMF IAQFYVAVFP VGDSPSAEGF FEAYLSFPLV MVMYIGHKIY KRNWKLFIPA EKMDIDTGRR EVDLDLLKQE IAEEKAIMAT KPRWYRIWNF WC. It is sometimes possible for the material contained within the vial of "General amino-acid permease GAP1 (GAP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
