BBSome-interacting protein 1 (BBIP1) Recombinant Protein | BBIP1 recombinant protein

Recombinant Human BBSome-interacting protein 1 (BBIP1)

Cat. Num. AAA1177737

• Gene Names: BBIP1; BBS18; BBIP10; bA348N5.3; NCRNA00081
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: BBSome-interacting protein 1 (BBIP1); Recombinant Human BBSome-interacting protein 1 (BBIP1); BBIP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-92, Full length protein
• Sequence: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH
• Sequence Length: 92

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 305855070
• NCBI GeneID: 92482
• NCBI Accession #: NP_001182233.1
• NCBI GenBank Nucleotide #: NM_001195304.1
• UniProt Accession #: A8MTZ0; E9PIY9; E9PM41; E9PRI7
• Molecular Weight: 11,459 Da
• NCBI Official Full Name: BBSome-interacting protein 1 isoform 1
• NCBI Official Synonym Full Names: BBSome interacting protein 1
• NCBI Official Symbol: BBIP1
• NCBI Official Synonym Symbols: BBS18; BBIP10; bA348N5.3; NCRNA00081
• NCBI Protein Information: BBSome-interacting protein 1
• UniProt Protein Name: BBSome-interacting protein 1
• Protein Family: BBSome-interacting protein
• UniProt Gene Name: BBIP1
• UniProt Synonym Gene Names: BBIP10; NCRNA00081

NCBI Description

This gene encodes one of eight proteins that form the BBSome complex and is essential for its assembly. The BBSome complex is involved in trafficking signal receptors to and from the cilia. Mutations in this gene result in Bardet-Biedl syndrome 18. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. Required for primary cilia assembly and BBSome stability. Regulates cytoplasmic microtubule stability and acetylation.