Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-6 (FZD6) Recombinant Protein | FZD6 recombinant protein

Recombinant Human Frizzled-6 (FZD6)

Gene Names
FZD6; FZ6; FZ-6; HFZ6; NDNC10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-6 (FZD6); Recombinant Human Frizzled-6 (FZD6); Recombinant Frizzled-6 (FZD6); Frizzled-6; Fz-6; hFz6; FZD6 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-706
Sequence
HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
Sequence Length
706
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,292 Da
NCBI Official Full Name
frizzled-6 isoform a
NCBI Official Synonym Full Names
frizzled family receptor 6
NCBI Official Symbol
FZD6
NCBI Official Synonym Symbols
FZ6; FZ-6; HFZ6; NDNC10
NCBI Protein Information
frizzled-6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor
UniProt Protein Name
Frizzled-6
Protein Family
UniProt Gene Name
FZD6
UniProt Synonym Gene Names
Fz-6; hFz6
UniProt Entry Name
FZD6_HUMAN

NCBI Description

This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants, some of which do not encode a protein with a predicted signal peptide.[provided by RefSeq, Aug 2011]

Uniprot Description

FZD6: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Detected in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, thymus, prostate, testis, ovary, small intestine and colon. In the fetus, expressed in brain, lung, liver and kidney. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, Fz/Smo family

Chromosomal Location of Human Ortholog: 8q22.3-q23.1

Cellular Component: cytoplasmic vesicle membrane; cell surface; apicolateral plasma membrane; integral to plasma membrane; apical plasma membrane; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; protein binding; ubiquitin protein ligase binding

Biological Process: platelet activation; G-protein coupled receptor protein signaling pathway; inner ear morphogenesis; hair follicle development; Wnt receptor signaling pathway, planar cell polarity pathway; negative regulation of transcription factor activity; neural tube closure; establishment of planar polarity; cell proliferation in midbrain

Disease: Nail Disorder, Nonsyndromic Congenital, 10

Research Articles on FZD6

Similar Products

Product Notes

The FZD6 fzd6 (Catalog #AAA1176651) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-706. The amino acid sequence is listed below: HSLFTCEPIT VPRCMKMAYN MTFFPNLMGH YDQSIAAVEM EHFLPLANLE CSPNIETFLC KAFVPTCIEQ IHVVPPCRKL CEKVYSDCKK LIDTFGIRWP EELECDRLQY CDETVPVTFD PHTEFLGPQK KTEQVQRDIG FWCPRHLKTS GGQGYKFLGI DQCAPPCPNM YFKSDELEFA KSFIGTVSIF CLCATLFTFL TFLIDVRRFR YPERPIIYYS VCYSIVSLMY FIGFLLGDST ACNKADEKLE LGDTVVLGSQ NKACTVLFML LYFFTMAGTV WWVILTITWF LAAGRKWSCE AIEQKAVWFH AVAWGTPGFL TVMLLAMNKV EGDNISGVCF VGLYDLDASR YFVLLPLCLC VFVGLSLLLA GIISLNHVRQ VIQHDGRNQE KLKKFMIRIG VFSGLYLVPL VTLLGCYVYE QVNRITWEIT WVSDHCRQYH IPCPYQAKAK ARPELALFMI KYLMTLIVGI SAVFWVGSKK TCTEWAGFFK RNRKRDPISE SRRVLQESCE FFLKHNSKVK HKKKHYKPSS HKLKVISKSM GTSTGATANH GTSAVAITSH DYLGQETLTE IQTSPETSMR EVKADGASTP RLREQDCGEP ASPAASISRL SGEQVDGKGQ AGSVSESARS EGRISPKSDI TDTGLAQSNN LQVPSSSEPS SLKGSTSLLV HPVSGVRKEQ GGGCHSDT. It is sometimes possible for the material contained within the vial of "Frizzled-6 (FZD6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.