Pre-mRNA-splicing factor SYF2 (SYF2) Recombinant Protein | SYF2 recombinant protein
Recombinant Human Pre-mRNA-splicing factor SYF2 (SYF2)
Gene Names
SYF2; P29; CBPIN; NTC31; fSAP29
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pre-mRNA-splicing factor SYF2 (SYF2); Recombinant Human Pre-mRNA-splicing factor SYF2 (SYF2); SYF2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-243, Full length protein
Sequence
AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
Sequence Length
242
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SYF2 recombinant protein
This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1
S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,569 Da
NCBI Official Full Name
pre-mRNA-splicing factor SYF2 isoform 1
NCBI Official Synonym Full Names
SYF2 pre-mRNA splicing factor
NCBI Official Symbol
SYF2
NCBI Official Synonym Symbols
P29; CBPIN; NTC31; fSAP29
NCBI Protein Information
pre-mRNA-splicing factor SYF2
UniProt Protein Name
Pre-mRNA-splicing factor SYF2
Protein Family
UniProt Gene Name
SYF2
UniProt Synonym Gene Names
CBPIN; GCIPIP
NCBI Description
This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Uniprot Description
May be involved in pre-mRNA splicing.
Research Articles on SYF2
Similar Products
Product Notes
The SYF2 syf2 (Catalog #AAA1176122) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-243, Full length protein. The amino acid sequence is listed below: AAIAASEVLV DSAEEGSLAA AAELAAQKRE QRLRKFRELH LMRNEARKLN HQEVVEEDKR LKLPANWEAK KARLEWELKE EEKKKECAAR GEDYEKVKLL EISAEDAERW ERKKKRKNPD LGFSDYAAAQ LRQYHRLTKQ IKPDMETYER LREKHGEEFF PTSNSLLHGT HVPSTEEIDR MVIDLEKQIE KRDKYSRRRP YNDDADIDYI NERNAKFNKK AERFYGKYTA EIKQNLERGT AV. It is sometimes possible for the material contained within the vial of "Pre-mRNA-splicing factor SYF2 (SYF2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
