Flagellar biosynthetic protein FliQ (fliQ) Recombinant Protein | fliQ recombinant protein
Recombinant Escherichia coli Flagellar biosynthetic protein FliQ (fliQ)
Gene Names
fliQ; ECK1947; flaQ; JW1933
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Flagellar biosynthetic protein FliQ (fliQ); Recombinant Escherichia coli Flagellar biosynthetic protein FliQ (fliQ); fliQ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-89
Sequence
MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVRTLFTNLPYIIG
Sequence Length
89
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for fliQ recombinant protein
fliQ; flaQ
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,632 Da
NCBI Official Full Name
flagellar biosynthesis protein
NCBI Official Symbol
fliQ
NCBI Official Synonym Symbols
ECK1947; flaQ; JW1933
NCBI Protein Information
flagellar biosynthesis protein
UniProt Protein Name
Flagellar biosynthetic protein FliQ
Protein Family
UniProt Gene Name
fliQ
UniProt Synonym Gene Names
flaQ
UniProt Entry Name
FLIQ_ECOLI
NCBI Description
Flagellar regulon. [More information is available at EcoGene: EG11976]. FliQ is one of six integral membrane components of the flagellar export apparatus . [More information is available at EcoCyc: EG11976].
Uniprot Description
Function: Required for the assembly of the rivet at the earliest stage of flagellar biosynthesis.
Subcellular location: Cell inner membrane; Multi-pass membrane protein
Probable. Bacterial flagellum basal body
By similarity.
Sequence similarities: Belongs to the FliQ/MopD/SpaQ family.
Similar Products
Product Notes
The fliQ fliq (Catalog #AAA1174527) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-89. The amino acid sequence is listed below: MTPESVMMMG TEAMKVALAL AAPLLLVALV TGLIISILQA ATQINEMTLS FIPKIIAVFI AIIIAGPWML NLLLDYVRTL FTNLPYIIG. It is sometimes possible for the material contained within the vial of "Flagellar biosynthetic protein FliQ (fliQ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
