Succinate/fumarate mitochondrial transporter (SFC1) Recombinant Protein | SFC1 recombinant protein
Recombinant Saccharomyces cerevisiae Succinate/fumarate mitochondrial transporter (SFC1)
Gene Names
SFC1; ACR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Succinate/fumarate mitochondrial transporter (SFC1); Recombinant Saccharomyces cerevisiae Succinate/fumarate mitochondrial transporter (SFC1); Recombinant Succinate/fumarate mitochondrial transporter (SFC1); Succinate/fumarate mitochondrial transporter; Regulator of acetyl-CoA synthase activity; SFC1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-322
Sequence
MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLGIFKKNDTPKPKPLK
Sequence Length
322
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,340 Da
NCBI Official Full Name
Sfc1p
NCBI Official Symbol
SFC1
NCBI Official Synonym Symbols
ACR1
NCBI Protein Information
Sfc1p
UniProt Protein Name
Succinate/fumarate mitochondrial transporter
Protein Family
UniProt Gene Name
SFC1
UniProt Synonym Gene Names
ACR1
UniProt Entry Name
SFC1_YEAST
Uniprot Description
Function: Transports cytoplasmic succinate, derived from isocitrate by the action of isocitrate lyase in the cytosol, into the mitochondrial matrix in exchange for fumarate.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.
Induction: By ethanol or acetate as sole carbon sources. Repressed by glucose.
Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
Similar Products
Product Notes
The SFC1 sfc1 (Catalog #AAA1172149) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-322. The amino acid sequence is listed below: MSQKKKASHP AINLMAGGTA GLFEALCCHP LDTIKVRMQI YRRVAGIEHV KPPGFIKTGR TIYQKEGFLA LYKGLGAVVI GIIPKMAIRF SSYEFYRTLL VNKESGIVST GNTFVAGVGA GITEAVLVVN PMEVVKIRLQ AQHLTPSEPN AGPKYNNAIH AAYTIVKEEG VSALYRGVSL TAARQATNQG ANFTVYSKLK EFLQNYHQMD VLPSWETSCI GLISGAIGPF SNAPLDTIKT RLQKDKSISL EKQSGMKKII TIGAQLLKEE GFRALYKGIT PRVMRVAPGQ AVTFTVYEYV REHLENLGIF KKNDTPKPKP LK. It is sometimes possible for the material contained within the vial of "Succinate/fumarate mitochondrial transporter (SFC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
