Protein Tat Recombinant Protein | tat recombinant protein

Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat

Cat. Num. AAA1170030

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein Tat; Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Tat; tat recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-101, Full length protein
• Sequence: MEPVDPNLEPWKHPGSQPRTACNNCYCKKCCFHCQVCFTKKGLGISYGRKKRRQRRRPPQDSQTHQSSLSKQPTSQLRGDPTGPTESKKKVERETETDPVH
• Sequence Length: 101

• Species: Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 549048
• UniProt Accession #: P35965
• Molecular Weight: 8,392 Da
• NCBI Official Full Name: Protein Tat
• UniProt Protein Name: Protein Tat
• Protein Family: Protein
• UniProt Gene Name: tat

Uniprot Description

Nuclear transcriptional activator of viral gene expression, that is essential for viral transcription from the LTR promoter and replication. Acts as a sequence-specific molecular adapter, directing components of the cellular transcription machinery to the viral RNA to promote processive transcription elongation by the RNA polymerase II (RNA pol II) complex, thereby increasing the level of full-length transcripts. In the absence of Tat, the RNA Pol II generates short or non-processive transcripts that terminate at approximately 60 bp from the initiation site. Tat associates with the CCNT1/cyclin-T1 component of the P-TEFb complex (CDK9 and CCNT1), which promotes RNA chain elongation. This binding increases Tat's affinity for a hairpin structure at the 5'-end of all nascent viral mRNAs referred to as the transactivation responsive RNA element (TAR RNA) and allows Tat/P-TEFb complex to bind cooperatively to TAR RNA. The CDK9 component of P-TEFb and other Tat-activated kinases hyperphosphorylate the C-terminus of RNA Pol II that becomes stabilized and much more processive. Other factors such as HTATSF1/Tat-SF1, SUPT5H/SPT5, and HTATIP2 are also important for Tat's function. Besides its effect on RNA Pol II processivity, Tat induces chromatin remodeling of proviral genes by recruiting the histone acetyltransferases (HATs) CREBBP, EP300 and PCAF to the chromatin. This also contributes to the increase in proviral transcription rate, especially when the provirus integrates in transcriptionally silent region of the host genome. To ensure maximal activation of the LTR, Tat mediates nuclear translocation of NF-kappa-B by interacting with host RELA. Through its interaction with host TBP, Tat may also modulate transcription initiation. Tat can reactivate a latently infected cell by penetrating in it and transactivating its LTR promoter. In the cytoplasm, Tat is thought to act as a translational activator of HIV-1 mRNAs.