Protein MurJ homolog (murJ) Recombinant Protein | mviN recombinant protein
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein MurJ homolog (murJ)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein MurJ homolog (murJ); Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein MurJ homolog (murJ); Recombinant Protein MurJ homolog (murJ); Protein MurJ homolog; mviN recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-511
Sequence
MNLLKPLISVSLMTLISRILGFVRDILIASIFGASMFTDAFFISFKIPNLLRRIFSDGTFSQAFIPVLMEYKSDKNEKNIKNFLSSILGFMSFFLLLLTILGGFFSQSIILIRAPGFLNPPEKLILSTNLLRIMFPYILLISLSSLCSSILNSWNYFSIPAFSPIFLNISIIFFSVFFSSFFCPSIIVLAWSVIIGGLVQLLYQLPFLYKINMLVLPNFHWNNIGLLRILKKMGPAILGASANQISLIINTIFSSLLNSGSISWIYYADRLIEFPVGILGVSLSTVLFTSLAKNYKNGIKLEYKKLLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTARVLKLYSCGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGIALSLSITSWVNFLLLSRKLYQRKIVSLQRSEFIFIIYIILATLVMIVILFVVLHMMSVWNIGTFINKIIRLFFGKYVSGITYLFMMNILGIRLLNFFYKNS
Sequence Length
511
Species
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,192 Da
NCBI Official Full Name
virulence factor MviN-like protein
NCBI Official Symbol
mviN
NCBI Protein Information
virulence factor MviN-like protein
UniProt Protein Name
Protein MurJ homolog
Protein Family
UniProt Gene Name
murJ
UniProt Synonym Gene Names
mviN
UniProt Entry Name
MURJ_BUCAI
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the MurJ/MviN family.
Similar Products
Product Notes
The mviN murj (Catalog #AAA1169192) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-511. The amino acid sequence is listed below: MNLLKPLISV SLMTLISRIL GFVRDILIAS IFGASMFTDA FFISFKIPNL LRRIFSDGTF SQAFIPVLME YKSDKNEKNI KNFLSSILGF MSFFLLLLTI LGGFFSQSII LIRAPGFLNP PEKLILSTNL LRIMFPYILL ISLSSLCSSI LNSWNYFSIP AFSPIFLNIS IIFFSVFFSS FFCPSIIVLA WSVIIGGLVQ LLYQLPFLYK INMLVLPNFH WNNIGLLRIL KKMGPAILGA SANQISLIIN TIFSSLLNSG SISWIYYADR LIEFPVGILG VSLSTVLFTS LAKNYKNGIK LEYKKLLDWG LRISLIVSLP GSVILFFLAK PVIIVLFQYG KFTDFDVLMT ARVLKLYSCG LISFIFVKIL SSAFYACEEI KIPMKASLFT LLLNQLMNPF LIFYFQHAGI ALSLSITSWV NFLLLSRKLY QRKIVSLQRS EFIFIIYIIL ATLVMIVILF VVLHMMSVWN IGTFINKIIR LFFGKYVSGI TYLFMMNILG IRLLNFFYKN S. It is sometimes possible for the material contained within the vial of "Protein MurJ homolog (murJ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
