Phytoene synthase 1, chloroplastic (PSY1) Recombinant Protein | PSY1 recombinant protein
Recombinant Solanum lycopersicum Phytoene synthase 1, chloroplastic (PSY1)
Gene Names
Psy1; psy; GTOM5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phytoene synthase 1; chloroplastic (PSY1); Recombinant Solanum lycopersicum Phytoene synthase 1; PSY1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
130-412, Full length protein
Sequence
EYAKTFNLGTMLMTPERRRAIWAIYVWCRRTDELVDGPNASYITPAALDRWENRLEDVFNGRPFDMLDGALSDTVSNFPVDIQPFRDMIEGMRMDLRKSRYKNFDELYLYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGRVTDKWRIFMKKQIHRARKFFDEAEKGVTELSSASRFPVWASLVLYRKILDEIEANDYNNFTKRAYVSKSKKLIALPIAYAKSLVPPTKTASLQR
Sequence Length
283
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,615 Da
NCBI Official Full Name
phytoene synthase 1, chloroplastic
NCBI Official Symbol
Psy1
NCBI Official Synonym Symbols
psy; GTOM5
NCBI Protein Information
phytoene synthase 1, chloroplastic
UniProt Protein Name
Phytoene synthase 1, chloroplastic
Protein Family
UniProt Gene Name
PSY1
UniProt Synonym Gene Names
GTOM5; PTOM5; TOM5
NCBI Description
This gene encodes phytoene synthase, the first enzyme in the carotenoid biosynthetic pathway which converts geranylgeranyl diphosphate (GGPP) to phytoene. Its disruption leads to lack of lycopene in fruits causing yellow flesh phenotype. This gene is one of the three phytoene synthase genes found in tomato. phytoene synthase 1 is most expressed in chromoplast-containing tissues, particularly in fruit. Alternative splicing and the use of alternative promoters results in multiple transcript variants.[provided by RefSeq, Dec 2016]
Uniprot Description
Catalyzes the reaction from prephytoene diphosphate to phytoene.
Research Articles on PSY1
Similar Products
Product Notes
The PSY1 psy1 (Catalog #AAA1168826) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 130-412, Full length protein. The amino acid sequence is listed below: EYAKTFNLGT MLMTPERRRA IWAIYVWCRR TDELVDGPNA SYITPAALDR WENRLEDVFN GRPFDMLDGA LSDTVSNFPV DIQPFRDMIE GMRMDLRKSR YKNFDELYLY CYYVAGTVGL MSVPIMGIAP ESKATTESVY NAALALGIAN QLTNILRDVG EDARRGRVYL PQDELAQAGL SDEDIFAGRV TDKWRIFMKK QIHRARKFFD EAEKGVTELS SASRFPVWAS LVLYRKILDE IEANDYNNFT KRAYVSKSKK LIALPIAYAK SLVPPTKTAS LQR. It is sometimes possible for the material contained within the vial of "Phytoene synthase 1, chloroplastic (PSY1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
