Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein P (P) Recombinant Protein | HHBVgp3 recombinant protein

Recombinant Heron hepatitis B virus Protein P (P), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein P (P); Recombinant Heron hepatitis B virus Protein P (P); partial; HHBVgp3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
376-565. Partial, provide the Reverse transcriptase Domain
Sequence
SYLRGNTSWPNRVTGRIFLVDKNSRNTEEARLVVDFSQFSKGKNAMRFPKYWCPNLTTLRRILPVGMPRISLDLSQAFYHLPLAPASSSRLAVSDGKQVYYFRKAPMGVGLSPFLLHLFTTAIGAEIASRFNVWTFSYMDDFLLCHPSARHLNTISHAVCTFLQEFGIRINFDKMTPSPVTTIRFLGYEI
Sequence Length
565
Species
Heron hepatitis B virus (HHBV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.7 kDa
NCBI Official Full Name
polymerase
NCBI Official Symbol
HHBVgp3
NCBI Protein Information
polymerase
UniProt Protein Name
Protein P
UniProt Gene Name
P

Uniprot Description

Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-)DNA is covalently linked to P protein. Partial (+)DNA is synthesized from the (-)DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA). The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+)DNA by host nuclear DNA repair machinery ().

Similar Products

Product Notes

The HHBVgp3 p (Catalog #AAA1165285) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 376-565. Partial, provide the Reverse transcriptase Domain. The amino acid sequence is listed below: SYLRGNTSWP NRVTGRIFLV DKNSRNTEEA RLVVDFSQFS KGKNAMRFPK YWCPNLTTLR RILPVGMPRI SLDLSQAFYH LPLAPASSSR LAVSDGKQVY YFRKAPMGVG LSPFLLHLFT TAIGAEIASR FNVWTFSYMD DFLLCHPSAR HLNTISHAVC TFLQEFGIRI NFDKMTPSPV TTIRFLGYEI . It is sometimes possible for the material contained within the vial of "Protein P (P), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.