SDS-PAGE
Lysobacter enzymogenes Beta-lytic metalloendopeptidase Recombinant Protein
Recombinant Lysobacter enzymogenes Beta-lytic metalloendopeptidase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lysobacter enzymogenes Beta-lytic metalloendopeptidase; Recombinant Lysobacter enzymogenes Beta-lytic metalloendopeptidase; Beta-lytic protease; Lysobacter enzymogenes Beta-lytic metalloendopeptidase recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-178aa; Full Length
Sequence
SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN
Sequence Length
178
Species
Lysobacter enzymogenes
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Lysobacter enzymogenes Beta-lytic metalloendopeptidase recombinant protein
Cleavage of N-acetylmuramoyl-|-Ala, and of the insulin B chain at 23-Gly-|-Phe-24 > 18-Val-|-Cys(SO3H).
References
Damaglou A.P., Allen L.C., Whitaker D.R.
Submitted (MAR-1974) to the PIR data bank
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
35.1 kDa
UniProt Protein Name
Beta-lytic metalloendopeptidase
UniProt Entry Name
PRLB_LYSEN
Similar Products
Product Notes
The Lysobacter enzymogenes Beta-lytic metalloendopeptidase (Catalog #AAA1159415) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-178aa; Full Length. The amino acid sequence is listed below: SPNGLLQFPF PRGASWHVGG AHTNTGSGNY PMSSLDMSRG GGSNQNGNWV SASAAGGSFK RHSSCFAEIV HTGGWSTTYY HLMNIQYNTG ANVSMNTAIA NAPNTQAQAL CNGGQSTGPH QHWSLKQNGS FYHLNGTYLS GYRITATGSS YDTNCSRFYL TKNGQNYCYG YYVNPGPN. It is sometimes possible for the material contained within the vial of "Lysobacter enzymogenes Beta-lytic metalloendopeptidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
