Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

H-2 class I histocompatibility antigen, K-D alpha chain Recombinant Protein | H2-K1 recombinant protein

Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
H-2 class I histocompatibility antigen; K-D alpha chain; Recombinant Mouse H-2 class I histocompatibility antigen; H2-K1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-305. Partial (The complete extracellular domain)
Sequence
GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for H2-K1 recombinant protein
Involved in the presentation of foreign antigens to the immune system.
References
Mouse histocompatibility genes structure and organisation of a Kd gene.Kvist S., Roberts L., Dobberstein B.EMBO J. 2:245-254(1983) A cDNA clone containing the entire coding sequence of a mouse H-2Kd histocompatibility antigen.Lalanne J.-L., Delarbre C., Gachelin G., Kourilsky P.Nucleic Acids Res. 11:1567-1577(1983) Girgis K.R., Capra D.J., Stroynowski I. Nucleotide sequences of three H-2K and three H-2D complementary DNA clones coding mouse class I MHC heavy chain proteins.Wang M., Stepkowski S.M., Hebert J.S., Tian L., Yu J., Kahan B.D.Ann. Transplant. 1:26-31(1996) Amino acid sequence of residues 1-98 of the K-2Kb murine major histocompatibility alloantigen comparison with H-2Kb and H-2db reveals extensive localized differences.Kimball E.S., Nathenson S.G., Coligan J.E.Biochemistry 20:3301-3308(1981) Oligosaccharide microheterogeneity of the murine major histocompatibility antigens. Reproducible site-specific patterns of sialylation and branching in asparagine-linked oligosaccharides.Swiedler S.J., Freed J.H., Tarentino A.L., Plummer T.H. Jr., Hart G.W.J. Biol. Chem. 260:4046-4054(1985) Large-scale phosphorylation analysis of mouse liver.Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
H-2 class I histocompatibility antigen, K-D alpha chain isoform X3
NCBI Official Symbol
LOC101056305
NCBI Protein Information
H-2 class I histocompatibility antigen, K-D alpha chain
UniProt Protein Name
H-2 class I histocompatibility antigen, K-D alpha chain
UniProt Gene Name
H2-K1
UniProt Synonym Gene Names
H2-K; H-2K(D)
UniProt Entry Name
HA1D_MOUSE

Uniprot Description

HLAC iso22: Involved in the presentation of foreign antigens to the immune system. Belongs to the MHC class I family.

Protein type: Membrane protein, integral; Receptor, misc.

Cellular Component: cell surface; endoplasmic reticulum; external side of plasma membrane; Golgi apparatus; Golgi medial cisterna; integral to membrane; membrane; MHC class I protein complex

Molecular Function: beta-2-microglobulin binding; peptide antigen binding; peptide binding; protein binding; protein heterodimerization activity; receptor binding; T cell receptor binding; TAP binding

Biological Process: antigen processing and presentation; antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of peptide antigen via MHC class I; defense response to bacterium; immune response; immune system process; inner ear development; positive regulation of T cell mediated cytotoxicity

Research Articles on H2-K1

Similar Products

Product Notes

The H2-K1 h2-k1 (Catalog #AAA1158913) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-305. Partial (The complete extracellular domain). The amino acid sequence is listed below: GPHSLRYFVT AVSRPGLGEP RFIAVGYVDD TQFVRFDSDA DNPRFEPRAP WMEQEGPEYW EEQTQRAKSD EQWFRVSLRT AQRYYNQSKG GSHTFQRMFG CDVGSDWRLL RGYQQFAYDG RDYIALNEDL KTWTAADTAA LITRRKWEQA GDAEYYRAYL EGECVEWLRR YLELGNETLL RTDSPKAHVT YHPRSQVDVT LRCWALGFYP ADITLTWQLN GEDLTQDMEL VETRPAGDGT FQKWAAVVVP LGKEQNYTCH VHHKGLPEPL TLRWKLPPST VSNT . It is sometimes possible for the material contained within the vial of "H-2 class I histocompatibility antigen, K-D alpha chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.