ATP-dependent DNA helicase uvsW (uvsW) Recombinant Protein | uvsW recombinant protein
Recombinant Enterobacteria phage T4 ATP-dependent DNA helicase uvsW (uvsW), partial
Gene Names
uvsW; dar
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent DNA helicase uvsW (uvsW); Recombinant Enterobacteria phage T4 ATP-dependent DNA helicase uvsW (uvsW); partial; uvsW recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
122-501. Partial
Sequence
VFEGLVNRRRILNLPTSAGKSLIQALLARYYLENYEGKILIIVPTTALTTQMADDFVDYRLFSHAMIKKIGGGASKDDKYKNDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSIISGLNNCMFKFGLSGSLRDGKANIMQYVGMFGEIFKPVTTSKLMEDGQVTELKINSIFLRYPDEFTTKLKGKTYQEEIKIITGLSKRNKWIAKLAIKLAQKDENAFVMFKHVSHGKAIFDLIKNEYDKVYYVSGEVDTETRNIMKTLAENGKGIIIVASYGVFSTGISVKNLHHVVLAHGVKSKIIVLQTIGRVLRKHGSKTIATVWDLIDSAGVKPKSANTKKKYVHLNYLLKHGIDRIQRYADEKFNYVMKTVN
Species
Enterobacteria phage T4 (Bacteriophage T4)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,525 Da
NCBI Official Full Name
UvsW RNA-DNA and DNA-DNA helicase, ATPase
NCBI Official Symbol
uvsW
NCBI Official Synonym Symbols
dar
NCBI Protein Information
UV repair and recombination protein
UniProt Protein Name
ATP-dependent DNA helicase uvsW
Protein Family
UniProt Gene Name
uvsW
UniProt Synonym Gene Names
dar
Uniprot Description
Plays important roles in recombination-dependent DNA repair and the reorganization of stalled replication forks during viral DNA synthesis.
Research Articles on uvsW
Similar Products
Product Notes
The uvsW uvsw (Catalog #AAA1156206) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 122-501. Partial. The amino acid sequence is listed below: VFEGLVNRRR ILNLPTSAGK SLIQALLARY YLENYEGKIL IIVPTTALTT QMADDFVDYR LFSHAMIKKI GGGASKDDKY KNDAPVVVGT WQTVVKQPKE WFSQFGMMMN DECHLATGKS ISSIISGLNN CMFKFGLSGS LRDGKANIMQ YVGMFGEIFK PVTTSKLMED GQVTELKINS IFLRYPDEFT TKLKGKTYQE EIKIITGLSK RNKWIAKLAI KLAQKDENAF VMFKHVSHGK AIFDLIKNEY DKVYYVSGEV DTETRNIMKT LAENGKGIII VASYGVFSTG ISVKNLHHVV LAHGVKSKII VLQTIGRVLR KHGSKTIATV WDLIDSAGVK PKSANTKKKY VHLNYLLKHG IDRIQRYADE KFNYVMKTVN. It is sometimes possible for the material contained within the vial of "ATP-dependent DNA helicase uvsW (uvsW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
