Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UDP-glucuronosyltransferase 2B2 (Ugt2b) Recombinant Protein | Ugt2b recombinant protein

Recombinant Rat UDP-glucuronosyltransferase 2B2 (Ugt2b)

Gene Names
Ugt2b; Ugt2b2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-glucuronosyltransferase 2B2 (Ugt2b); Recombinant Rat UDP-glucuronosyltransferase 2B2 (Ugt2b); Recombinant UDP-glucuronosyltransferase 2B2 (Ugt2b); UDP-glucuronosyltransferase 2B2; UDPGT 2B2 EC= 2.4.1.17; 3-hydroxyandrogen-specific UDPGT RLUG23 UDPGTr-4; Ugt2b recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-530
Sequence
GKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQNHFIKLLDVWTYELPRDTCLSYSPILQNLVYEFSYFYLSICKDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHKLEKSIGKFILPPSYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEILGRPTTVDETMSKVEIWLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSSGEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRTMSKLDFLSALEEVIDNPFYKKNVMLLSTIHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPLGHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFMYRFFVKKEKKMKNE
Sequence Length
530
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
60,986 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 2B2
NCBI Official Synonym Full Names
UDP glycosyltransferase 2 family, polypeptide B
NCBI Official Symbol
Ugt2b
NCBI Official Synonym Symbols
Ugt2b2
NCBI Protein Information
UDP-glucuronosyltransferase 2B2; RLUG23; UDPGTr-4; UDPGT 2B2; 3-hydroxyandrogen specific; UDP glucuronosyltransferase; 3-hydroxyandrogen-specific UDPGT; Androsterone UDP-glucuronosyltransferase
UniProt Protein Name
UDP-glucuronosyltransferase 2B2
UniProt Gene Name
Ugt2b
UniProt Synonym Gene Names
Ugt2b2; UDPGT 2B2
UniProt Entry Name
UD2B2_RAT

NCBI Description

enzyme involved in conjugating lipophilic aglycon substrates with glucuronic acid [RGD, Feb 2006]

Uniprot Description

Ugt2b38: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. 2B2 acts on various endogenous steroids, especially etiocholanolone and androsterone

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; integral to membrane

Molecular Function: transferase activity, transferring hexosyl groups; glucuronosyltransferase activity

Biological Process: flavonoid biosynthetic process; metabolic process; cellular response to hormone stimulus

Similar Products

Product Notes

The Ugt2b ugt2b (Catalog #AAA1152639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-530. The amino acid sequence is listed below: GKVLVWPMDF SHWMNIKIIL DELVQRGHEV TVLKPSAYFF LDPKKSSDLK FEIFSTSISK DELQNHFIKL LDVWTYELPR DTCLSYSPIL QNLVYEFSYF YLSICKDAVS NKQLMTKLQE SKFDVLFADP VASCGDLIAE LLHIPFLYSL SFSPGHKLEK SIGKFILPPS YVPVILSGLA GKMTFIDRVK NMICMLYFDF WFERLRHKEW DTFYSEILGR PTTVDETMSK VEIWLIRSYW DLKFPHPTLP NVDYIGGLHC KPAKPLPKDM EEFVQSSGEH GVVVFSLGSM VSNMTEEKAN AIAWALAQIP QKVLWKFDGK TPATLGPNTR VYKWLPQNDL LGHPKTKAFV THGGANGLYE AIYHGIPMIG IPLFGDQPDN IAHMVAKGAA VSLNIRTMSK LDFLSALEEV IDNPFYKKNV MLLSTIHHDQ PMKPLDRAVF WIEFIMRHKG AKHLRPLGHN LPWYQYHSLD VIGFLLTCFA VIAALTVKCL LFMYRFFVKK EKKMKNE. It is sometimes possible for the material contained within the vial of "UDP-glucuronosyltransferase 2B2 (Ugt2b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.