High affinity potassium transporter (HAK1) Recombinant Protein | HAK1 recombinant protein
Recombinant Schwanniomyces occidentalis High affinity potassium transporter (HAK1), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity potassium transporter (HAK1); Recombinant Schwanniomyces occidentalis High affinity potassium transporter (HAK1); partial; HAK1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-821
Sequence
MSDSQSNKQNQGEDDNNVSSSIESNENYPFRLNDEESEPQSSTTESMLKAKKQSWRQVLMLGFSSLGAIYGDIGTSPLYVLNSIKYPNSSPTEEDIYGAISIIFYLFTFIVIFKYILIVLFLGTNDGEGGQVAIYAKIARSLKIGPKGVHIPGSPEKTDLELLARAETSSSFKSSNLFLNKASGFKTNPKLIKFISKFILFGCFFGCSLVMSDGLLTPTTSVLSAIAGIQIANPSFNDVLAVSEVVLIVLFLIQQFGSNKISFTFAPIIFLWLIGLIISGIYNIVKFHPAVFKSLSPYYAIQLLKHSGIDVFSGAMLSITGTEAMFADVGHFGRLPIQLTLTLFVYPALIICYLGQGAYIIKHPEALSNPFFYSIPGGLNSWIYWVMFVLATLSTIIASQALILGVFSITSQLINLDCFPNFKIIHVSKKYAGKVYIPAINWLLMIGVCATTAGFKNSNNVTAAYGLGITLDFLVTSSLIMVCMTYVYNWNILIPITYALIFLPLEVIMVISNLKKITHGAWFPLMMSGIFMMFLSFWRWARSRKVNQDFKTRIRIGDLYPELKKQPPQSETVDLNDRGRPMSIVNSSNEELVEYGVTLPKILKTNNNQLKVQSKFGLMNLKKYDGIAIMYNDSSVHTLNSPNTVPQVYGKLVSSFSSIPSVFIFCSIRVLSIPTVPNDERVLIGSMKIPGHYRCIIRYGFMEEILIDKELNNHILNSIPDINELAIKFNLNNKCILTKPCTIPILHIFENNLIRSHDYSSEEHETKNPLVKCKRFIRKILINHIFSPIYSDFQSNGKFLKISDEDEESEKKMFLGGVVRI
Sequence Length
821
Species
Schwanniomyces occidentalis (Yeast) (Debaryomyces occidentalis)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
91,935 Da
NCBI Official Full Name
High affinity potassium transporter
UniProt Protein Name
High affinity potassium transporter
Protein Family
UniProt Gene Name
HAK1
Uniprot Description
Major high-affinity potassium uptake protein.
Similar Products
Product Notes
The HAK1 hak1 (Catalog #AAA1148736) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-821. The amino acid sequence is listed below: MSDSQSNKQN QGEDDNNVSS SIESNENYPF RLNDEESEPQ SSTTESMLKA KKQSWRQVLM LGFSSLGAIY GDIGTSPLYV LNSIKYPNSS PTEEDIYGAI SIIFYLFTFI VIFKYILIVL FLGTNDGEGG QVAIYAKIAR SLKIGPKGVH IPGSPEKTDL ELLARAETSS SFKSSNLFLN KASGFKTNPK LIKFISKFIL FGCFFGCSLV MSDGLLTPTT SVLSAIAGIQ IANPSFNDVL AVSEVVLIVL FLIQQFGSNK ISFTFAPIIF LWLIGLIISG IYNIVKFHPA VFKSLSPYYA IQLLKHSGID VFSGAMLSIT GTEAMFADVG HFGRLPIQLT LTLFVYPALI ICYLGQGAYI IKHPEALSNP FFYSIPGGLN SWIYWVMFVL ATLSTIIASQ ALILGVFSIT SQLINLDCFP NFKIIHVSKK YAGKVYIPAI NWLLMIGVCA TTAGFKNSNN VTAAYGLGIT LDFLVTSSLI MVCMTYVYNW NILIPITYAL IFLPLEVIMV ISNLKKITHG AWFPLMMSGI FMMFLSFWRW ARSRKVNQDF KTRIRIGDLY PELKKQPPQS ETVDLNDRGR PMSIVNSSNE ELVEYGVTLP KILKTNNNQL KVQSKFGLMN LKKYDGIAIM YNDSSVHTLN SPNTVPQVYG KLVSSFSSIP SVFIFCSIRV LSIPTVPNDE RVLIGSMKIP GHYRCIIRYG FMEEILIDKE LNNHILNSIP DINELAIKFN LNNKCILTKP CTIPILHIFE NNLIRSHDYS SEEHETKNPL VKCKRFIRKI LINHIFSPIY SDFQSNGKFL KISDEDEESE KKMFLGGVVR I. It is sometimes possible for the material contained within the vial of "High affinity potassium transporter (HAK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
