Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuroendocrine secretory protein 55 (GNAS) Recombinant Protein | GNAS recombinant protein

Recombinant Bovine Neuroendocrine secretory protein 55 (GNAS)

Gene Names
GNAS; SCG6; GNAS1; NESP55
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuroendocrine secretory protein 55 (GNAS); Recombinant Bovine Neuroendocrine secretory protein 55 (GNAS); GNAS recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
47-241, Full length protein
Sequence
TSSTRAQQRAAAQRRTFLNAHHRSAAQVFPEPPESDHEDTDFEPSLPECPEYQEEEFDYESETESESEIESETEFETESDTAPTTEPETEPEDEPGPVVPKRPTFHQSLTERLSALRLRSPDASPSRAPPSTQESESPRQGEEPEDKDPRDPEESEEPKEEEKQQQHRCKPKKPTRRDPSPESPSKRGAIPIRRH
Sequence Length
195
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GNAS recombinant protein
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5 exons. Some transcripts contains a differentially methylated region (DMR) at their 5 exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,709 Da
NCBI Official Full Name
SCG6 (secretogranin VI) isoform SCG6
NCBI Official Symbol
GNAS
NCBI Official Synonym Symbols
SCG6; GNAS1; NESP55
NCBI Protein Information
GNAS complex locus; SCG6 (secretogranin VI)
UniProt Protein Name
Neuroendocrine secretory protein 55
UniProt Gene Name
GNAS
UniProt Synonym Gene Names
NESP55

Uniprot Description

MiscellaneousThis protein is produced by a bicistronic gene which also produces the ALEX protein from an overlapping reading frame.

Research Articles on GNAS

Similar Products

Product Notes

The GNAS gnas (Catalog #AAA1143628) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 47-241, Full length protein. The amino acid sequence is listed below: TSSTRAQQRA AAQRRTFLNA HHRSAAQVFP EPPESDHEDT DFEPSLPECP EYQEEEFDYE SETESESEIE SETEFETESD TAPTTEPETE PEDEPGPVVP KRPTFHQSLT ERLSALRLRS PDASPSRAPP STQESESPRQ GEEPEDKDPR DPEESEEPKE EEKQQQHRCK PKKPTRRDPS PESPSKRGAI PIRRH. It is sometimes possible for the material contained within the vial of "Neuroendocrine secretory protein 55 (GNAS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.