Ubiquitin-activating enzyme E1 1 (UBA1) Recombinant Protein | UBA1 recombinant protein
Recombinant Arabidopsis thaliana Ubiquitin-activating enzyme E1 1 (UBA1) , partial
Gene Names
UBA1; ATUBA1; MODIFIER OF SNC1 5; MOS5; T27E13.15; T27E13_15; ubiquitin-activating enzyme 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-activating enzyme E1 1 (UBA1); Recombinant Arabidopsis thaliana Ubiquitin-activating enzyme E1 1 (UBA1); partial; UBA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
656-920. Partial
Sequence
MCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTLERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRFPRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDAKIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDDTNYHMDVIAGLANMRARNYSIPEVDKLKAKFIAGR
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
120,251 Da
NCBI Official Full Name
ubiquitin-activating enzyme 1
NCBI Official Symbol
UBA1
NCBI Official Synonym Symbols
ATUBA1; MODIFIER OF SNC1 5; MOS5; T27E13.15; T27E13_15; ubiquitin-activating enzyme 1
NCBI Protein Information
ubiquitin-activating enzyme 1
UniProt Protein Name
Ubiquitin-activating enzyme E1 1
Protein Family
UniProt Gene Name
UBA1
UniProt Synonym Gene Names
MOS5; AtUBA1
NCBI Description
Encodes a ubiquitin-activating enzyme (E1), involved in the first step in conjugating multiple ubiquitins to proteins targeted for degradation. Gene is expressed in most tissues examined. Mutant is able to revert the constitutive defense responses phenotype of snc1, which indicates the gene is involved in defense response. It also indicates that ubiquitination plays a role in plant defense signalling.
Uniprot Description
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP.
Research Articles on UBA1
Similar Products
Product Notes
The UBA1 uba1 (Catalog #AAA1140371) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 656-920. Partial. The amino acid sequence is listed below: MCTVHSFPHN IDHCLTWARS EFEGLLEKTP AEVNAYLSSP VEYTNSMMSA GDAQARDTLE RIVECLEKEK CETFQDCLTW ARLRFEDYFV NRVKQLIYTF PEDAATSTGA PFWSAPKRFP RPLQYSSSDP SLLNFITATA ILRAETFGIP IPEWTKNPKE AAEAVDRVIV PDFEPRQDAK IVTDEKATTL TTASVDDAAV IDDLIAKIDQ CRHNLSPDFR MKPIQFEKDD DTNYHMDVIA GLANMRARNY SIPEVDKLKA KFIAGR. It is sometimes possible for the material contained within the vial of "Ubiquitin-activating enzyme E1 1 (UBA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
