Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

60 kDa heat shock protein, mitochondrial (HSPD1) Recombinant Protein | HSPD1 recombinant protein

Recombinant Mesocricetus auratus 60 kDa heat shock protein, mitochondrial (HSPD1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
60 kDa heat shock protein; mitochondrial (HSPD1); Recombinant Mesocricetus auratus 60 kDa heat shock protein; HSPD1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-271, full length protein
Sequence
ALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKLVQDVANNTNEEAGDGTTTATVLARGANPVEIRRGVMLAVDAVIAELKKTLNDELEIIEGMKFDRGYISPYFINTSKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAHDLGKIQEITEQLDITTSEYEKEKVTDALNATRAAVEEGIVLGGGCALLRIGIEIIKR
Sequence Length
271
Species
Mesocricetus auratus (Golden hamster)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
29,037 Da
NCBI Official Full Name
60 kDa heat shock protein, mitochondrial
UniProt Protein Name
60 kDa heat shock protein, mitochondrial
Protein Family
UniProt Gene Name
HSPD1
UniProt Synonym Gene Names
Hsp60

Uniprot Description

Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein.

Similar Products

Product Notes

The HSPD1 hspd1 (Catalog #AAA1136097) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-271, full length protein. The amino acid sequence is listed below: ALMLQGVDLL ADAVAVTMGP KGRTVIIEQS WGSPKLVQDV ANNTNEEAGD GTTTATVLAR GANPVEIRRG VMLAVDAVIA ELKKTLNDEL EIIEGMKFDR GYISPYFINT SKCEFQDAYV LLSEKKISSV QSIVPALEIA NAHRKPLVII AEDVDGEALS TLVLNRVGLQ VVAVKAPGFG DNRKNQLKDM AIATGGAVFG EEGLNLNLED VQAHDLGKIQ EITEQLDITT SEYEKEKVTD ALNATRAAVE EGIVLGGGCA LLRIGIEIIK R. It is sometimes possible for the material contained within the vial of "60 kDa heat shock protein, mitochondrial (HSPD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.