Membrane-bound lytic murein transglycosylase F (mltF) Recombinant Protein | mltF recombinant protein
Recombinant Actinobacillus pleuropneumoniae serotype 3 Membrane-bound lytic murein transglycosylase F (mltF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane-bound lytic murein transglycosylase F (mltF); Recombinant Actinobacillus pleuropneumoniae serotype 3 Membrane-bound lytic murein transglycosylase F (mltF); mltF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-483, Full length
Sequence
WDMVFPWQQLMQAEENRYNQIQQRKILRVGMVNHPLSYFIGAEGTAGIEYELAKSFANYLDVRLDIKTFDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASWQVVYKKGSNRPYKLSELEGDLIIPAGSAVLPILQRLKEDNPKLSWQTTNQFTQEELLLQVAEGKIPYTVGISVDISAAQHIRPNIAVGFDLTDEAPVLWYLPNSSYSELQAAVLDFMNHANETGLISRIEEKYFNHLAHFDYVDIQSYLKAIKLVLPKYQSLFEKYRGDLEWQMLAAIAYQESHWDPNATSPTGVRGMMMLTRDTAERMKITDRTSAEQSIRAGSEYLHMLMRQIPETVPKEDRIWYGLAAYNMGFGHLLDVRRLTRQLGGNPDNWLDVKKNLPLLAEKRHYSGLKYGYARGFEAFQYVENIRRYYSSIINHQRVEEQQIQNNEEQPSVPQEISKESDSTLKE
Sequence Length
465
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,554 Da
NCBI Official Full Name
lytic transglycosylase F
UniProt Protein Name
Membrane-bound lytic murein transglycosylase F
Protein Family
UniProt Gene Name
mltF
Uniprot Description
Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.
Similar Products
Product Notes
The mltF mltf (Catalog #AAA1133301) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-483, Full length. The amino acid sequence is listed below: WDMVFPWQQL MQAEENRYNQ IQQRKILRVG MVNHPLSYFI GAEGTAGIEY ELAKSFANYL DVRLDIKTFD NSEQLFSALK DNKVDIAAAG LLYQPELSKQ FQIGSAYYSA SWQVVYKKGS NRPYKLSELE GDLIIPAGSA VLPILQRLKE DNPKLSWQTT NQFTQEELLL QVAEGKIPYT VGISVDISAA QHIRPNIAVG FDLTDEAPVL WYLPNSSYSE LQAAVLDFMN HANETGLISR IEEKYFNHLA HFDYVDIQSY LKAIKLVLPK YQSLFEKYRG DLEWQMLAAI AYQESHWDPN ATSPTGVRGM MMLTRDTAER MKITDRTSAE QSIRAGSEYL HMLMRQIPET VPKEDRIWYG LAAYNMGFGH LLDVRRLTRQ LGGNPDNWLD VKKNLPLLAE KRHYSGLKYG YARGFEAFQY VENIRRYYSS IINHQRVEEQ QIQNNEEQPS VPQEISKESD STLKE. It is sometimes possible for the material contained within the vial of "Membrane-bound lytic murein transglycosylase F (mltF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
