Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nucleoprotein (NP) Recombinant Protein | NP recombinant protein

Recombinant Influenza A virus Nucleoprotein (NP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoprotein (NP); Recombinant Influenza A virus Nucleoprotein (NP); NP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-498, Full length protein
Sequence
MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLNDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRXLVLYDKEEIRRIWRQANNGDDATAGLTHIMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVLELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVGIDPFKLLQTSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRVSSFIRGTKVIPRGKLSTRGVQIASNENMDTMVSSTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPFDKTTIMAAFTGNAEGRTSDMRAEIIKMMESARPEEVSFQGRGVFEFSDERAANPIVPSFDMSNEGSYFFGDNAEEYDN
Sequence Length
498
Species
Influenza A virus (strain A/Chile/1/1983 H1N1)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
56,020 Da
NCBI Official Full Name
Nucleoprotein
UniProt Protein Name
Nucleoprotein
Protein Family
UniProt Gene Name
NP
UniProt Synonym Gene Names
Protein N

Uniprot Description

Encapsidates the negative strand viral RNA, protecting it from nucleases. The encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication. The RNP needs to be localized in the host nucleus to start an infectious cycle, but is too large to diffuse through the nuclear pore complex. NP comprises at least 2 nuclear localization signals that are responsible for the active RNP import into the nucleus through cellular importin alpha/beta pathway. Later in the infection, nclear export of RNPs are mediated through viral proteins NEP interacting with M1 which binds nucleoproteins. It is possible that nucleoprotein binds directly host exportin-1/XPO1 and plays an active role in RNPs nuclear export. M1 interaction with RNP seems to hide nucleoprotein's nuclear localization signals. Soon after a virion infects a new cell, M1 dissociates from the RNP under acidification of the virion driven by M2 protein. Dissociation of M1 from RNP unmasks nucleoprotein's nuclear localization signals, targeting the RNP to the nucleus.

Similar Products

Product Notes

The NP np (Catalog #AAA1128014) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-498, Full length protein. The amino acid sequence is listed below: MASQGTKRSY EQMETDGERQ NATEIRASVG KMIGGIGRFY IQMCTELKLN DYEGRLIQNS LTIERMVLSA FDERRNKYLE EHPSAGKDPK KTGGPIYKRV DGKWMRXLVL YDKEEIRRIW RQANNGDDAT AGLTHIMIWH SNLNDTTYQR TRALVRTGMD PRMCSLMQGS TLPRRSGAAG AAVKGVGTMV LELIRMIKRG INDRNFWRGE NGRKTRIAYE RMCNILKGKF QTAAQRAMMD QVRESRNPGN AEIEDLTFLA RSALILRGSV AHKSCLPACV YGPAVASGYD FEKEGYSLVG IDPFKLLQTS QVYSLIRPNE NPAHKSQLVW MACNSAAFED LRVSSFIRGT KVIPRGKLST RGVQIASNEN MDTMVSSTLE LRSRYWAIRT RSGGNTNQQR ASAGQISIQP TFSVQRNLPF DKTTIMAAFT GNAEGRTSDM RAEIIKMMES ARPEEVSFQG RGVFEFSDER AANPIVPSFD MSNEGSYFFG DNAEEYDN. It is sometimes possible for the material contained within the vial of "Nucleoprotein (NP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.