Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteinase-activated receptor 1 (f2r) Recombinant Protein | f2r recombinant protein

Recombinant Xenopus laevis Proteinase-activated receptor 1 (f2r)

Gene Names
f2r; par1; f2r-a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteinase-activated receptor 1 (f2r); Recombinant Xenopus laevis Proteinase-activated receptor 1 (f2r); Recombinant Proteinase-activated receptor 1 (f2r); Proteinase-activated receptor 1; PAR-1; Thrombin receptor; f2r recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
43-420
Sequence
TFRIFDDSESEFEEIPWDELDESGEGSGDQAPVSRSARKPIRRNITKEAEQYLSSQWLTKFVPSLYTVVFIVGLPLNLLAIIIFLFKMKVRKPAVVYMLNLAIADVFFVSVLPFKIAYHLSGNDWLFGPGMCRIVTAIFYCNMYCSVLLIASISVDRFLAVVYPMHSLSWRTMSRAYMACSFIWLISIASTIPLLVTEQTQKIPRLDITTCHDVLDLKDLKDFYIYYFSSFCLLFFFVPFIITTICYIGIIRSLSSSSIENSCKKTRALFLAVVVLCVFIICFGPTNVLFLTHYLQEANEFLYFAYILSACVGSVSCCLDPLIYYYASSQCQRYLYSLLCCRKVSEPGSSTGQLMSTAMKNDNCSTNAKSSIYKKLLA
Sequence Length
420
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,436 Da
NCBI Official Full Name
proteinase-activated receptor 1
NCBI Official Synonym Full Names
coagulation factor 2 (thrombin) receptor<
NCBI Official Symbol
f2r
NCBI Official Synonym Symbols
par1; f2r-a
NCBI Protein Information
proteinase-activated receptor 1; PAR-1; thrombin receptor; coagulation factor II receptor; coagulation factor II (thrombin) receptor
UniProt Protein Name
Proteinase-activated receptor 1
UniProt Gene Name
f2r
UniProt Synonym Gene Names
PAR-1
UniProt Entry Name
PAR1_XENLA

Uniprot Description

Function: High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Post-translational modification: A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Similar Products

Product Notes

The f2r f2r (Catalog #AAA1118065) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 43-420. The amino acid sequence is listed below: TFRIFDDSES EFEEIPWDEL DESGEGSGDQ APVSRSARKP IRRNITKEAE QYLSSQWLTK FVPSLYTVVF IVGLPLNLLA IIIFLFKMKV RKPAVVYMLN LAIADVFFVS VLPFKIAYHL SGNDWLFGPG MCRIVTAIFY CNMYCSVLLI ASISVDRFLA VVYPMHSLSW RTMSRAYMAC SFIWLISIAS TIPLLVTEQT QKIPRLDITT CHDVLDLKDL KDFYIYYFSS FCLLFFFVPF IITTICYIGI IRSLSSSSIE NSCKKTRALF LAVVVLCVFI ICFGPTNVLF LTHYLQEANE FLYFAYILSA CVGSVSCCLD PLIYYYASSQ CQRYLYSLLC CRKVSEPGSS TGQLMSTAMK NDNCSTNAKS SIYKKLLA. It is sometimes possible for the material contained within the vial of "Proteinase-activated receptor 1 (f2r), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.