Heterogeneous nuclear ribonucleoprotein 87F (Hrb87F) Recombinant Protein | Hrb87F recombinant protein
Recombinant Drosophila melanogaster Heterogeneous nuclear ribonucleoprotein 87F (Hrb87F)
Gene Names
Hrb87F; CG12749; DmelCG12749; hnRNP A2/B1; hnRNP36; hnRNPA1; hnRNPA1/A2; hnRNPA2; Hrb2; Hrb85CD; Hrb87f; HRB87F; HRB87F/hrp36; Hrb87Fa; hrp36; Hrp36; HRP36; P11; P11/Hrb87F; p38; Q14; Q16
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein 87F (Hrb87F); Recombinant Drosophila melanogaster Heterogeneous nuclear ribonucleoprotein 87F (Hrb87F); Hrb87F recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-385, Full length protein
Sequence
MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGGGQGFAGNNYNTGGGGQGGNMGGGNRRY
Sequence Length
385
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,670 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein at 87F, isoform C
NCBI Official Synonym Full Names
Heterogeneous nuclear ribonucleoprotein at 87F
NCBI Official Symbol
Hrb87F
NCBI Official Synonym Symbols
CG12749; DmelCG12749; hnRNP A2/B1; hnRNP36; hnRNPA1; hnRNPA1/A2; hnRNPA2; Hrb2; Hrb85CD; Hrb87f; HRB87F; HRB87F/hrp36; Hrb87Fa; hrp36; Hrp36; HRP36; P11; P11/Hrb87F; p38; Q14; Q16
NCBI Protein Information
CG12749 gene product from transcript CG12749-RD
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein 87F
Protein Family
UniProt Gene Name
Hrb87F
UniProt Synonym Gene Names
hrp36
Uniprot Description
This protein is a component of ribonucleosomes. Could be needed to organize a concentration gradient of a dorsalizing morphogen (Dm) originating in the germinal vesicle.
Research Articles on Hrb87F
1. The hnRNP A1 homolog Hrb87F/Hrp36 is important for telomere maintenance in Drosophila melanogaster.
Similar Products
Product Notes
The Hrb87F hrb87f (Catalog #AAA1116468) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-385, Full length protein. The amino acid sequence is listed below: MAEQNDSNGN YDDGEEITEP EQLRKLFIGG LDYRTTDDGL KAHFEKWGNI VDVVVMKDPK TKRSRGFGFI TYSQSYMIDN AQNARPHKID GRTVEPKRAV PRQEIDSPNA GATVKKLFVG GLRDDHDEEC LREYFKDFGQ IVSVNIVSDK DTGKKRGFAF IEFDDYDPVD KIILQKTHSI KNKTLDVKKA IAKQDMDRQG GGGGRGGPRA GGRGGQGDRG QGGGGWGGQN RQNGGGNWGG AGGGGGFGNS GGNFGGGQGG GSGGWNQQGG SGGGPWNNQG GGNGGWNGGG GGGYGGGNSN GSWGGNGGGG GGGGGFGNEY QQSYGGGPQR NSNFGNNRPA PYSQGGGGGG FNKGNQGGGQ GFAGNNYNTG GGGQGGNMGG GNRRY. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein 87F (Hrb87F), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
