Monopolar spindle protein 2 (MPS2) Recombinant Protein | ZYRO0G08712g recombinant protein
Recombinant Zygosaccharomyces rouxii Monopolar spindle protein 2 (MPS2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monopolar spindle protein 2 (MPS2); Recombinant Zygosaccharomyces rouxii Monopolar spindle protein 2 (MPS2); Recombinant Monopolar spindle protein 2 (MPS2); Monopolar spindle protein 2; ZYRO0G08712g recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-343
Sequence
MDFDKSSSSLVLDLAWNQVDKKNQDFIYAKDFPALIMSIEEILSRGQQTPLAFLSNTGKSVIDTFAREKEFFKIYRDEFKEIFHGLVGKTFKDTIEGTNVSRSVLDEQGQEPDVSTTPTRQQRSSPRKVNRLLKNLETRVASMKDELKFKDEILAEKDRELIQLTRKLSDYKDKYEFVQRQFSFYKDHGESPRRNSSESEQLNLEQNASTKHEFIISELKRKLQEQTLAISNLKEQLQRGEGAGVLYTNYSKRYNPLHNDGPMVLVLATLVFLTIILLIGSMIWVTGGKDDSNSFSQYSWWENNSLLSRIGWFFRDWSDTGVDYVNFEPSSDAYERIMGIRRI
Sequence Length
343
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,859 Da
NCBI Official Full Name
ZYRO0G08712p
NCBI Official Symbol
ZYRO0G08712g
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Monopolar spindle protein 2
UniProt Gene Name
MPS2
UniProt Entry Name
MPS2_ZYGRC
Uniprot Description
Function: Component of the spindle pole body (SPB) required for insertion of the nascent SPB into the nuclear envelope and for the proper execution of spindle pole body (SPB) duplication
By similarity.
Subcellular location: Nucleus membrane; Single-pass membrane protein
By similarity. Cytoplasm › cytoskeleton › spindle pole body
By similarity.
Sequence similarities: Belongs to the MPS2 family.
Similar Products
Product Notes
The ZYRO0G08712g mps2 (Catalog #AAA1109726) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-343. The amino acid sequence is listed below: MDFDKSSSSL VLDLAWNQVD KKNQDFIYAK DFPALIMSIE EILSRGQQTP LAFLSNTGKS VIDTFAREKE FFKIYRDEFK EIFHGLVGKT FKDTIEGTNV SRSVLDEQGQ EPDVSTTPTR QQRSSPRKVN RLLKNLETRV ASMKDELKFK DEILAEKDRE LIQLTRKLSD YKDKYEFVQR QFSFYKDHGE SPRRNSSESE QLNLEQNAST KHEFIISELK RKLQEQTLAI SNLKEQLQRG EGAGVLYTNY SKRYNPLHND GPMVLVLATL VFLTIILLIG SMIWVTGGKD DSNSFSQYSW WENNSLLSRI GWFFRDWSDT GVDYVNFEPS SDAYERIMGI RRI. It is sometimes possible for the material contained within the vial of "Monopolar spindle protein 2 (MPS2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
