Protein translocase subunit SecF (secF) Recombinant Protein | secF recombinant protein
Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF (secF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein translocase subunit SecF (secF); Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF (secF); Recombinant Protein translocase subunit SecF (secF); Protein translocase subunit SecF; secF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-324
Sequence
MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNFGIDFRGGTTIRTESTQAVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQDATQSITPEQIGQVEEALKTVDPSITFPSVESVGPKVSGELIRSAILAVAAACAGIAVYIWLRFEWQFALGSVAALIHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFDRLRENLVKYKTMPLRDVMNLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAITFGVVIGTYSSVYMAKNIVLYLGVDRGGPKKDSKAGTQFANIDA
Sequence Length
324
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,088 Da
NCBI Official Full Name
preprotein translocase subunit SecF
NCBI Official Symbol
secF
NCBI Protein Information
preprotein translocase subunit SecF
UniProt Protein Name
Protein translocase subunit SecF
Protein Family
UniProt Gene Name
secF
UniProt Entry Name
SECF_RHOS4
Uniprot Description
Function: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA
By similarity. HAMAP-Rule MF_01464
Subunit structure: Forms a complex with SecD. Part of the essential Sec protein translocation apparatus which comprises SecA, SecYEG and auxiliary proteins SecDF-YajC and YidC
By similarity.
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01464.
Sequence similarities: Belongs to the SecD/SecF family. SecF subfamily.
Similar Products
Product Notes
The secF secf (Catalog #AAA1108022) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-324. The amino acid sequence is listed below: MAFRLKLCPE KTNIDFFWAA PVTFGFSVFL MAASLVAWLT LGLNFGIDFR GGTTIRTEST QAVDVAAYRA ALEGQDLGDI SITEVFDPGF RADQHVAMVR IGAQDATQSI TPEQIGQVEE ALKTVDPSIT FPSVESVGPK VSGELIRSAI LAVAAACAGI AVYIWLRFEW QFALGSVAAL IHDVLVTIGV FALFQIKFDL TTVAALLTVL GYSINDTVVV FDRLRENLVK YKTMPLRDVM NLSVNETLSR TIMTLMTTLI ALVSLLVFGG DVIRGFVFAI TFGVVIGTYS SVYMAKNIVL YLGVDRGGPK KDSKAGTQFA NIDA. It is sometimes possible for the material contained within the vial of "Protein translocase subunit SecF (secF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
