Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD) Recombinant Protein | hopD recombinant protein
Recombinant Haemophilus influenzae Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD); Recombinant Haemophilus influenzae Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD); Recombinant Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD); Putative type 4 prepilin-like proteins leader peptide-processing enzyme EC= 3.4.23.43; hopD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-230
Sequence
MIYFTMFLLGGILGIALWFYLSGFITRLQQNIYAIYVELFPQNRSPFQPHFASIQQKKCGHILRYFFSIGVGFIFLQIAFKDSIFTVWIGLTLIILWTISYLDWHYQLISTTPCLWLLTLGLFGADNNFSLLTLSESIKSAASFFIVFYVIYWLAKFYYGKEAFGRGDYWLAMALGSFIHLETLPHFLLLASVLGICFSLIHRKKKEFLPFAPFMNLSAVIIYFVKYYGY
Sequence Length
230
Species
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,789 Da
NCBI Official Full Name
type 4 prepilin-like protein specific leader peptidase
NCBI Official Symbol
hopD
NCBI Protein Information
type 4 prepilin-like protein specific leader peptidase
UniProt Protein Name
Putative type 4 prepilin-like proteins leader peptide-processing enzyme
Protein Family
UniProt Gene Name
hofD
UniProt Synonym Gene Names
hopD
UniProt Entry Name
LEP4_HAEIN
Uniprot Description
Function: Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue
By similarity.
Catalytic activity: Typically cleaves a -Gly-|-Phe- bond to release an N-terminal, basic peptide of 5-8 residues from type IV prepilin, and then N-methylates the new N-terminal amino group, the methyl donor being S-adenosyl-L-methionine.
Subcellular location: Cell inner membrane; Multi-pass membrane protein
Probable.
Sequence similarities: Belongs to the peptidase A24 family.
Similar Products
Product Notes
The hopD hofd (Catalog #AAA1107448) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-230. The amino acid sequence is listed below: MIYFTMFLLG GILGIALWFY LSGFITRLQQ NIYAIYVELF PQNRSPFQPH FASIQQKKCG HILRYFFSIG VGFIFLQIAF KDSIFTVWIG LTLIILWTIS YLDWHYQLIS TTPCLWLLTL GLFGADNNFS LLTLSESIKS AASFFIVFYV IYWLAKFYYG KEAFGRGDYW LAMALGSFIH LETLPHFLLL ASVLGICFSL IHRKKKEFLP FAPFMNLSAV IIYFVKYYGY. It is sometimes possible for the material contained within the vial of "Putative type 4 prepilin-like proteins leader peptide-processing enzyme (hofD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
