Caveolin-2 (CAV2) Recombinant Protein | CAV2 recombinant protein
Recombinant Dog Caveolin-2 (CAV2)
Gene Names
CAV2; CAV-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Caveolin-2 (CAV2); Recombinant Dog Caveolin-2 (CAV2); CAV2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-162, Full length protein
Sequence
MGLETEKADVQLCMDDDAYSRHSAVDFGDLEQLADSGSDRDPRRLNSHLQVGFEDVIAEPVSTHSFDKVWICSHALFEVSKYVIYKFLTLLLAMPMAFAAGVLFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAVIAPLCSSVGRSFSSVSLQVSHD
Sequence Length
162
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CAV2 recombinant protein
This protein is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,512 Da
NCBI Official Full Name
caveolin-2
NCBI Official Synonym Full Names
caveolin 2
NCBI Official Symbol
CAV2
NCBI Official Synonym Symbols
CAV-2
NCBI Protein Information
caveolin-2
UniProt Protein Name
Caveolin-2
Protein Family
UniProt Gene Name
CAV2
UniProt Synonym Gene Names
CAV-2
Uniprot Description
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression ().
Similar Products
Product Notes
The CAV2 cav2 (Catalog #AAA1104831) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-162, Full length protein. The amino acid sequence is listed below: MGLETEKADV QLCMDDDAYS RHSAVDFGDL EQLADSGSDR DPRRLNSHLQ VGFEDVIAEP VSTHSFDKVW ICSHALFEVS KYVIYKFLTL LLAMPMAFAA GVLFATLSCL HIWIIMPFVK TCLMVLPSVQ TIWKSVTDAV IAPLCSSVGR SFSSVSLQVS HD. It is sometimes possible for the material contained within the vial of "Caveolin-2 (CAV2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
