Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serine protease HTRA2, mitochondrial (HtrA2) Recombinant Protein | DvirGJ24448 recombinant protein

Recombinant Drosophila virilis Serine protease HTRA2, mitochondrial (HtrA2)

Gene Names
DvirGJ24448; dvir_GLEANR_9725; GJ24448
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine protease HTRA2; mitochondrial (HtrA2); Recombinant Drosophila virilis Serine protease HTRA2; Recombinant Serine protease HTRA2; mitochondrial EC= 3.4.21.108; High temperature requirement protein A2; DvirGJ24448 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
74-421
Sequence
ALASTMVAQREELTPTISARALSGRRREFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPNTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAARRRKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRTQNMPNTLSHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADGKKELDIVILRGVKQMRVTITPEDP
Sequence Length
421
Species
Drosophila virilis (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,903 Da
NCBI Official Full Name
GJ24448
NCBI Official Symbol
DvirGJ24448
NCBI Official Synonym Symbols
dvir_GLEANR_9725; GJ24448
NCBI Protein Information
GJ24448 gene product from transcript GJ24448-RA; DvirGJ24448-PA
UniProt Protein Name
Serine protease HTRA2, mitochondrial
UniProt Gene Name
HtrA2
UniProt Entry Name
HTRA2_DROVI

Uniprot Description

Function: Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th

By similarity. UniProtKB Q9VFJ3

Catalytic activity: Cleavage of non-polar aliphatic amino-acids at the P1 position, with a preference for Val, Ile and Met. At the P2 and P3 positions, Arg is selected most strongly with a secondary preference for other hydrophilic residues.

Subunit structure: Interacts with th/DIAP1 (via BIR 2 domain)

By similarity. UniProtKB Q9VFJ3

Subcellular location: Mitochondrion intermembrane space; Single-pass membrane protein

By similarity. Mitochondrion membrane; Single-pass membrane protein

Potential.

Sequence similarities: Belongs to the peptidase S1B family.Contains 1 PDZ (DHR) domain.

Similar Products

Product Notes

The DvirGJ24448 htra2 (Catalog #AAA1103770) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 74-421. The amino acid sequence is listed below: ALASTMVAQR EELTPTISAR ALSGRRREFN FIADVVAGCA DSVVYIEIKD TRHFDYFSGQ PITASNGSGF VIEQNGLILT NAHVVINKPN TMVQVRLSDG RTFPATIEDV DQTSDLATLR IQVNNLSVMK LGKSSTLRSG EWVVALGSPL ALSNTVTAGV ISSTQRASQE LGLRNRDINY LQTDAAITFG NSGGPLVNLD GEAIGVNSMK VTAGISFAIP IDYVKVFLER AAARRRKGSA YKTGYPVKRY MGITMLTLTP DILFELKSRT QNMPNTLSHG VLVWKVIVGS PAHSGGLQPG DIVTHINKKE IKNSSDVYDA LADGKKELDI VILRGVKQMR VTITPEDP. It is sometimes possible for the material contained within the vial of "Serine protease HTRA2, mitochondrial (HtrA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.