Uncharacterized protein MG284 homolog (MPN_403) Recombinant Protein | MPN_403 recombinant protein
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG284 homolog (MPN_403)
Gene Names
MPN403; F11_orf122a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein MG284 homolog (MPN_403); Recombinant Mycoplasma pneumoniae Uncharacterized protein MG284 homolog (MPN_403); MPN_403 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-122, Full length protein
Sequence
MSFKVKNQSKHLYSLMTKFKRSQLILKHQSNNFASELWNEEDIIRSKQFIELIEDTLLHLKKDTVDFIYDIFIYGKKPCDISYSNSTYYKKLNKAANSFFDHFVWEAPIYKTKELKNDNSHS
Sequence Length
122
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,611 Da
NCBI Official Full Name
hypothetical protein MPN403
NCBI Official Symbol
MPN403
NCBI Official Synonym Symbols
F11_orf122a
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Uncharacterized protein MG284 homolog
UniProt Gene Name
MPN_403
Uniprot Description
Enzyme and pathway databasesBioCyc Collection of Pathway/Genome DatabasesMore...BioCyciMPNE272634:G1GJ3-646-MONOMER.
Similar Products
Product Notes
The MPN_403 mpn_403 (Catalog #AAA1102313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-122, Full length protein. The amino acid sequence is listed below: MSFKVKNQSK HLYSLMTKFK RSQLILKHQS NNFASELWNE EDIIRSKQFI ELIEDTLLHL KKDTVDFIYD IFIYGKKPCD ISYSNSTYYK KLNKAANSFF DHFVWEAPIY KTKELKNDNS HS. It is sometimes possible for the material contained within the vial of "Uncharacterized protein MG284 homolog (MPN_403), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
