SDS-PAGE
Outer membrane protein OmpK Recombinant Protein | ompK recombinant protein
Recombinant Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Outer membrane protein OmpK
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane protein OmpK; Recombinant Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Outer membrane protein OmpK; Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633); ompK recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-266aa; Full Length
Sequence
ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF
Sequence Length
266
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ompK recombinant protein
Serves as receptor for a broad-host-range vibriophage, KVP40.
References
"Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V. cholerae."
Makino K., Oshima K., Kurokawa K., Yokoyama K., Uda T., Tagomori K., Iijima Y., Najima M., Nakano M., Yamashita A., Kubota Y., Kimura S., Yasunaga T., Honda T., Shinagawa H., Hattori M., Iida T.
Lancet 361:743-749(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.9 kDa
NCBI Official Full Name
outer membrane protein OmpK
NCBI Official Symbol
VP2362
NCBI Protein Information
outer membrane protein OmpK
UniProt Protein Name
Outer membrane protein OmpK
Protein Family
UniProt Gene Name
ompK
UniProt Entry Name
OMPK_VIBPA
Uniprot Description
Serves as receptor for a broad-host-range vibriophage, KVP40.
Similar Products
Product Notes
The ompK ompk (Catalog #AAA1099545) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-266aa; Full Length. The amino acid sequence is listed below: ADYSDGDIHK NDYKWMQFNL MGAFDELPGE SSHDYLEMEF GGRSGIFDLY GYVDVFNLAS DKGSDKVGDP KIFMKFAPRM SIDGLTGKDL SFGPVQELYV ATLFEWDGTD YKTNPFSVNN QKVGIGSDVM VPWFGKVGVN LYGTYQGNQK DWNGFQISTN WFKPFYFFEN GSFISYQGYI DYQFGMKEKY SSASNGGAMF NGIYWHSDRF AVGYGLKGYK DVYGIKDSDA LKSTGFGHYV AVTYKF. It is sometimes possible for the material contained within the vial of "Outer membrane protein OmpK, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
