Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Large envelope protein (S) Recombinant Protein | GSHVgp3 recombinant protein

Recombinant Ground squirrel hepatitis virus Large envelope protein (S)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Large envelope protein (S); Recombinant Ground squirrel hepatitis virus Large envelope protein (S); Recombinant Large envelope protein (S); Large envelope protein; L glycoprotein L-HBsAg; LHB Large S protein Large surface protein Major surface antigen; GSHVgp3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-428
Sequence
GNNIKVTFDPNKLAAWWPTVGTYYTPTTTVTNPAIFKPGIYQTTSLKNPKNQQELDAILMTRYKEIDWDNWQGFPVNQRLPVSNNNPPSGQRAETFEIKSRPIIVPGIRDIPRGIVPPQTPSNRDQRRKPTPLTPPLRDTHPHLTMKNQTGHLQGFAEGLRALTTSDHHNSAYGDPFTTLSPVVPTVSTTLSPPLTIGDPVLSTEMSPSGLLGLLAGLQVVYFLWTKILTIAQSLDWWWTSLSFPGGIPECTGQNLQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLFLTFLLVLLDWKGLLPVCPMMPATETTVNCRQCTISAQDTFTTPYCCCLKPTAGNCTCWPIPSSWALGSYLWEWALARFSWLSLLVPLLQWLGGISLTVWLLLIWMIWFWGPVLMSILPPFIPIFALFFLIWAYI
Sequence Length
428
Species
Ground squirrel hepatitis virus (strain 27) (GSHV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,383 Da
NCBI Official Full Name
hypothetical protein
NCBI Official Symbol
GSHVgp3
NCBI Protein Information
pre-surface antigen; hypothetical protein
UniProt Protein Name
Large envelope protein
UniProt Gene Name
S
UniProt Synonym Gene Names
LHB
UniProt Entry Name
HBSAG_GSHV

Uniprot Description

Function: The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. The large envelope protein probably also assumes fusion between virion and host membranes. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein

By similarity.The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid

By similarity.

Subunit structure: Li-HBsAg interacts with capsid protein and with HDV Large delta antigen. Isoform M associates with host chaperone CANX through its pre-S2 N glycan. This association may be essential for M proper secretion

By similarity.

Subcellular location: Virion membrane

By similarity.

Domain: The large envelope protein is synthesized with the pre-S region at the cytosolic side of the endoplasmic reticulum and, hence will be within the virion after budding. Therefore the pre-S region is not N-glycosylated. Later a post-translational translocation of N-terminal pre-S and TM1 domains occur in about 50% of proteins at the virion surface. These molecules change their topology by an unknown mechanism, resulting in exposure of pre-S region at virion surface. For isoform M in contrast, the pre-S2 region is translocated cotranslationally to the endoplasmic reticulum lumen and is N-glycosylated.

Post-translational modification: Isoform M is N-terminally acetylated at a ratio of 90%, and N-glycosylated at the pre-S2 region

By similarity.Myristoylated

By similarity.

Sequence similarities: Belongs to the orthohepadnavirus major surface antigen family.

Sequence caution: The sequence AAA46757.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The GSHVgp3 s (Catalog #AAA1092216) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-428. The amino acid sequence is listed below: GNNIKVTFDP NKLAAWWPTV GTYYTPTTTV TNPAIFKPGI YQTTSLKNPK NQQELDAILM TRYKEIDWDN WQGFPVNQRL PVSNNNPPSG QRAETFEIKS RPIIVPGIRD IPRGIVPPQT PSNRDQRRKP TPLTPPLRDT HPHLTMKNQT GHLQGFAEGL RALTTSDHHN SAYGDPFTTL SPVVPTVSTT LSPPLTIGDP VLSTEMSPSG LLGLLAGLQV VYFLWTKILT IAQSLDWWWT SLSFPGGIPE CTGQNLQFQT CKHLPTSCPP TCNGFRWMYL RRFIIYLLVL LLFLTFLLVL LDWKGLLPVC PMMPATETTV NCRQCTISAQ DTFTTPYCCC LKPTAGNCTC WPIPSSWALG SYLWEWALAR FSWLSLLVPL LQWLGGISLT VWLLLIWMIW FWGPVLMSIL PPFIPIFALF FLIWAYI. It is sometimes possible for the material contained within the vial of "Large envelope protein (S), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.