Transcription factor Sox-17-beta.3 (sox17b.3) Recombinant Protein | sox17b.3 recombinant protein
Recombinant Xenopus laevis Transcription factor Sox-17-beta.3 (sox17b.3)
Gene Names
sox17b.2.L; sox17; Xsox17; sox17b.2; sox17b.3; tSox17beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor Sox-17-beta.3 (sox17b.3); Recombinant Xenopus laevis Transcription factor Sox-17-beta.3 (sox17b.3); sox17b.3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-373, Full length protein
Sequence
MSSPDCGYASDDQIQRSCSLPMMMGQYQWTEPRTVFQEGKPKRDEVSANSRSKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLNLATKRPFVEEAERLRVQHIQDYPDYKYRPRRKKQVKRMKREEECFFPSANIPGPEAMVNNVMVGQKYKMQYSVQNLQENQLPTAGYFEGHSPMGYFYKDYDVPNYYTSQNSSGYCSPPTQDEYQALSYGFGSSYMPYQQTTTTPVMAKQISVTQNIPQESPEHGMMASPQMYNGQMYLPECAKTHPVAQTEQHSPSHQSQQMVSQNYLQSQQDGHLETDIDKTEFDQYLMYEPKSDPELIYTIDQDSGPYSTNLLPSLISEANNVCYYDYCGV
Sequence Length
373
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,124 Da
NCBI Official Full Name
transcription factor Sox-17-beta.3
NCBI Official Synonym Full Names
SRY (sex determining region Y)-box 17 beta, gene 2 L homeolog
NCBI Official Symbol
sox17b.2.L
NCBI Official Synonym Symbols
sox17; Xsox17; sox17b.2; sox17b.3; tSox17beta
NCBI Protein Information
transcription factor Sox-17-beta.3
UniProt Protein Name
Transcription factor Sox-17-beta.3
Protein Family
UniProt Gene Name
sox17b.3
Uniprot Description
Transcription activator. Doesn't appear to bind to the consensus 5'-AACAAT-3' DNA binding site, but binds 5'-ATTGTT-3'. All of the sox17 proteins are required for embryonic endoderm development and gastrulation movements, and show some redundancy in function. In addition, the sox17 proteins have distinct but overlapping roles in later gut development. Acts downstream of vegt-signaling in endoderm differentiation to induce a range of endodermal genes both directly and indirectly. Also represses wnt-responsive genes to inhibit wnt/beta-catenin-mediated signaling ().
Similar Products
Product Notes
The sox17b.3 sox17b.3 (Catalog #AAA1090448) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-373, Full length protein. The amino acid sequence is listed below: MSSPDCGYAS DDQIQRSCSL PMMMGQYQWT EPRTVFQEGK PKRDEVSANS RSKAEARIRR PMNAFMVWAK DERKRLAQQN PDLHNAELSK MLGKSWKSLN LATKRPFVEE AERLRVQHIQ DYPDYKYRPR RKKQVKRMKR EEECFFPSAN IPGPEAMVNN VMVGQKYKMQ YSVQNLQENQ LPTAGYFEGH SPMGYFYKDY DVPNYYTSQN SSGYCSPPTQ DEYQALSYGF GSSYMPYQQT TTTPVMAKQI SVTQNIPQES PEHGMMASPQ MYNGQMYLPE CAKTHPVAQT EQHSPSHQSQ QMVSQNYLQS QQDGHLETDI DKTEFDQYLM YEPKSDPELI YTIDQDSGPY STNLLPSLIS EANNVCYYDY CGV. It is sometimes possible for the material contained within the vial of "Transcription factor Sox-17-beta.3 (sox17b.3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
