Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Movement protein TGB2 (ORF3) Recombinant Protein | PVX_gp3 recombinant protein

Recombinant Potato virus X Movement protein TGB2 (ORF3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Movement protein TGB2 (ORF3); Recombinant Potato virus X Movement protein TGB2 (ORF3); PVX_gp3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-115
Sequence
MSAQGHRLTAPVNSEKVYIVLGLSFALVSITFLLSRNSLPHVGDNIHSLPHGGAYRDGTKAILYNSPNLGSRVSLHNGKNAAFAAVLLLTLLIYGSKYISQRNHTCACGNNHSSH
Sequence Length
115
Species
Potato virus X (PVX)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,338 Da
NCBI Official Full Name
12K protein
NCBI Official Symbol
PVX_gp3
NCBI Protein Information
12K protein
UniProt Protein Name
Movement protein TGB2
UniProt Gene Name
TGBp2
UniProt Synonym Gene Names
TGBp2
UniProt Entry Name
TGB2_PVX

Uniprot Description

Function: Plays a role in viral cell-to-cell propagation, by facilitating genome transport to neighboring plant cells through plasmosdesmata,

By similarity.

Subcellular location: Host endoplasmic reticulum membrane

By similarity.

Miscellaneous: TGBp1, TGBp2 and TGBp3 seem to act together for cell-to-cell propagation. TGBp1 is the main movement protein that physically cross the plasmodesma with the viral genome. TGBp2 and TGBp3 would facilitate TGBp1 function.

Sequence similarities: Belongs to the Tymovirales TGBp2 protein family.

Similar Products

Product Notes

The PVX_gp3 tgbp2 (Catalog #AAA1080267) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-115. The amino acid sequence is listed below: MSAQGHRLTA PVNSEKVYIV LGLSFALVSI TFLLSRNSLP HVGDNIHSLP HGGAYRDGTK AILYNSPNLG SRVSLHNGKN AAFAAVLLLT LLIYGSKYIS QRNHTCACGN NHSSH. It is sometimes possible for the material contained within the vial of "Movement protein TGB2 (ORF3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.