Membrane-bound lytic murein transglycosylase A (mltA) Recombinant Protein | mltA recombinant protein
Recombinant Escherichia coli Membrane-bound lytic murein transglycosylase A (mltA)
Gene Names
mltA; ECK2809; JW2784; mlt; ygdM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane-bound lytic murein transglycosylase A (mltA); Recombinant Escherichia coli Membrane-bound lytic murein transglycosylase A (mltA); mltA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-365, full length protein
Sequence
CSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRAGWYNHYGRVWVLKTAPGAGNVFSG
Sequence Length
345
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,411 Da
NCBI Official Full Name
membrane-bound lytic murein transglycosylase A
NCBI Official Symbol
mltA
NCBI Official Synonym Symbols
ECK2809; JW2784; mlt; ygdM
NCBI Protein Information
membrane-bound lytic murein transglycosylase A
UniProt Protein Name
Membrane-bound lytic murein transglycosylase A
Protein Family
UniProt Gene Name
mltA
UniProt Synonym Gene Names
mlt; ygdM
NCBI Description
MltA cleaves the glycosidic bonds between the N-acetylmuramic acid and N-acetylglucosamine residues in murein. [More information is available at EcoGene: EG13085]. MltA is one of six (along with MltB, MltC, MltD, EmtA, and Slt70) major lytic endotransglycosylases expressed in Escherichia coli. [More information is available at EcoCyc: G7457].
Uniprot Description
Murein-degrading enzyme. May play a role in recycling of muropeptides during cell elongation and/or cell division. Degrades murein glycan strands and insoluble, high-molecular weight murein sacculi.
Research Articles on mltA
1. crystallographic analysis of Escherichia coli Lytic transglycosylase MltA with bound chitohexaose
Similar Products
Product Notes
The mltA mlta (Catalog #AAA1065938) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-365, full length protein. The amino acid sequence is listed below: CSSKPTDRGQ QYKDGKFTQP FSLVNQPDAV GAPINAGDFA EQINHIRNSS PRLYGNQSNV YNAVQEWLRA GGDTRNMRQF GIDAWQMEGA DNYGNVQFTG YYTPVIQARH TRQGEFQYPI YRMPPKRGRL PSRAEIYAGA LSDKYILAYS NSLMDNFIMD VQGSGYIDFG DGSPLNFFSY AGKNGHAYRS IGKVLIDRGE VKKEDMSMQA IRHWGETHSE AEVRELLEQN PSFVFFKPQS FAPVKGASAV PLVGRASVAS DRSIIPPGTT LLAEVPLLDN NGKFNGQYEL RLMVALDVGG AIKGQHFDIY QGIGPEAGHR AGWYNHYGRV WVLKTAPGAG NVFSG. It is sometimes possible for the material contained within the vial of "Membrane-bound lytic murein transglycosylase A (mltA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
