Putative phosphotransferase enzyme IIA component yadI (yadI) Recombinant Protein | yadI recombinant protein
Recombinant Escherichia coli Putative phosphotransferase enzyme IIA component yadI (yadI)
Gene Names
yadI; agaX; ECK0128; JW0125
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative phosphotransferase enzyme IIA component yadI (yadI); Recombinant Escherichia coli Putative phosphotransferase enzyme IIA component yadI (yadI); yadI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-146, full length protein
Sequence
MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACRETMTSSEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY
Sequence Length
146
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,540 Da
NCBI Official Full Name
putative PTS Enzyme IIA
NCBI Official Symbol
yadI
NCBI Official Synonym Symbols
agaX; ECK0128; JW0125
NCBI Protein Information
putative PTS Enzyme IIA
UniProt Protein Name
Putative phosphotransferase enzyme IIA component YadI
Protein Family
UniProt Gene Name
yadI
NCBI Description
YadI was propose to be the IIA(Aga), but the real EnzymeIIA(Aga) is deleted from Escherichia coli K12. [More information is available at EcoGene: EG12322]. AgaX is the Enzyme IIA domain of a predicted N-acetylgalactosamine-transporting PEP-dependent phosphotransferase system. [More information is available at EcoCyc: EG12322].
Uniprot Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane.
Similar Products
Product Notes
The yadI yadi (Catalog #AAA1047621) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-146, full length protein. The amino acid sequence is listed below: MLGWVITCHD DRAQEILDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG APEVSSLWHQ QQKNPPFVLK HNLYEY. It is sometimes possible for the material contained within the vial of "Putative phosphotransferase enzyme IIA component yadI (yadI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
