Motility protein A (motA) Recombinant Protein | TP0725 recombinant protein
Recombinant Treponema pallidum Motility protein A (motA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Motility protein A (motA); Recombinant Treponema pallidum Motility protein A (motA); TP0725 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-259
Sequence
MDIASFIGLFGGFAIIIFGAVLGGSARGLFHVPSLLITVGGSYLTLFLTYPLSYAVGVFRVIARVFHAADFHEREIVQRLYALAEKSRRTGLLALEEEIQDFDDDFVRTGLRNVVDGVDGDAIKALMESELTHMEDRHNTWISLLNSWAALAPGYGMLGTVMGLIGMLATLEDKSSLGSNMATALITTFYGSLVQNWFITPVATKLQYQHDLEVKSKEMVIEGVLSIQAGDHPRVLAQRLLTYLSPKMRKELEMELIKD
Sequence Length
259
Species
Treponema pallidum (strain Nichols)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for TP0725 recombinant protein
motA
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,645 Da
NCBI Official Full Name
flagellar motor rotation protein (motA)
NCBI Official Symbol
TP0725
NCBI Protein Information
flagellar motor rotation protein (motA)
UniProt Protein Name
Motility protein A
UniProt Gene Name
motA
UniProt Entry Name
MOTA_TREPA
Uniprot Description
Function: MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel
By similarity.
Subunit structure: Each stator complex is composed of 4 MotA and 2 MotB subunits. 2 A subunits and 1 B subunit are thought to form a single ion channel, so that each stator complex contains two channels
By similarity.
Subcellular location: Cell inner membrane
By similarity; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the MotA family.
Similar Products
Product Notes
The TP0725 mota (Catalog #AAA1046957) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-259. The amino acid sequence is listed below: MDIASFIGLF GGFAIIIFGA VLGGSARGLF HVPSLLITVG GSYLTLFLTY PLSYAVGVFR VIARVFHAAD FHEREIVQRL YALAEKSRRT GLLALEEEIQ DFDDDFVRTG LRNVVDGVDG DAIKALMESE LTHMEDRHNT WISLLNSWAA LAPGYGMLGT VMGLIGMLAT LEDKSSLGSN MATALITTFY GSLVQNWFIT PVATKLQYQH DLEVKSKEMV IEGVLSIQAG DHPRVLAQRL LTYLSPKMRK ELEMELIKD. It is sometimes possible for the material contained within the vial of "Motility protein A (motA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
