Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HTR2B is 0.03 ng/ml as a capture antibody.)

Mouse HTR2B Monoclonal Antibody | anti-HTR2B antibody

HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B, 5-HT(2B), 5-HT2B) (APC)

Gene Names
HTR2B; 5-HT2B; 5-HT-2B; 5-HT(2B)
Applications
Western Blot
Purity
Purified
Synonyms
HTR2B; Monoclonal Antibody; HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B; 5-HT(2B); 5-HT2B) (APC); 5-hydroxytryptamine (Serotonin) Receptor 2B; 5-HT2B; anti-HTR2B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A4
Specificity
Recognizes HTR2B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HTR2B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HTR2B (NP_000858, 1aa-56aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HTR2B is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HTR2B is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-HTR2B antibody
Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens. [supplied by OMIM]
Product Categories/Family for anti-HTR2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 2B isoform 1
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 2B
NCBI Official Symbol
HTR2B
NCBI Official Synonym Symbols
5-HT2B; 5-HT-2B; 5-HT(2B)
NCBI Protein Information
5-hydroxytryptamine receptor 2B
UniProt Protein Name
5-hydroxytryptamine receptor 2B
UniProt Gene Name
HTR2B
UniProt Synonym Gene Names
5-HT-2B; 5-HT2B
UniProt Entry Name
5HT2B_HUMAN

NCBI Description

This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]

Uniprot Description

5-HT(2B): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q36.3-q37.1

Cellular Component: neuron projection; integral to plasma membrane; cytoplasm; plasma membrane; synapse; cell junction

Molecular Function: serotonin binding; serotonin receptor activity; G-protein alpha-subunit binding; drug binding

Biological Process: heart morphogenesis; negative regulation of autophagy; cGMP biosynthetic process; phosphoinositide 3-kinase cascade; intestine smooth muscle contraction; behavior; positive regulation of MAP kinase activity; protein kinase C activation; positive regulation of cell proliferation; neural crest cell differentiation; embryonic morphogenesis; neural crest cell migration; serotonin receptor signaling pathway; regulation of behavior; positive regulation of cytokine production; response to drug; vasoconstriction; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of nitric-oxide synthase activity; calcium-mediated signaling; positive regulation of phosphatidylinositol biosynthetic process; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; G-protein coupled receptor internalization; phospholipase C activation; release of sequestered calcium ion into cytosol; positive regulation of cell division; positive regulation of endothelial cell proliferation; phosphorylation; negative regulation of apoptosis; positive regulation of cytokine secretion

Research Articles on HTR2B

Similar Products

Product Notes

The HTR2B htr2b (Catalog #AAA6170068) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HTR2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HTR2B htr2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HTR2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.