Positive regulator of late transcription (C) Recombinant Protein | Mup21 recombinant protein
Recombinant Enterobacteria phage Mu Positive regulator of late transcription (C)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Positive regulator of late transcription (C); Recombinant Enterobacteria phage Mu Positive regulator of late transcription (C); Mup21 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-140, Full length protein
Sequence
MQHDLFEHDPAIRQLIGHIDNIPAPELESRWPRSVVDLIDVLENELKRQNVSNPRELARKQAVALSCFLGGRQFYIPCGDTILTALRDDLLYCQFNGRNMEELRRQYRLSQPQIYQIIARQRKLHTRRHQPDLFSPETPK
Sequence Length
140
Species
Enterobacteria phage Mu (Bacteriophage Mu)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,514 Da
NCBI Official Full Name
putative transcription regulator
NCBI Official Symbol
Mup21
NCBI Protein Information
C
UniProt Protein Name
Late transcription activator C
UniProt Gene Name
C
UniProt Synonym Gene Names
C; gp21
Uniprot Description
Positive regulator of viral late genes transcription. Responsible for the transition from middle to late gene expression. Activates the Plys, PI, PP and Pmom late promoters thereby allowing the expression of viral endolysin and structural genes. Activates Pmom promoter by unwinding the DNA, thus realigning the promoter elements and recruiting the RNAP.
Research Articles on Mup21
Similar Products
Product Notes
The Mup21 c (Catalog #AAA1029143) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-140, Full length protein. The amino acid sequence is listed below: MQHDLFEHDP AIRQLIGHID NIPAPELESR WPRSVVDLID VLENELKRQN VSNPRELARK QAVALSCFLG GRQFYIPCGD TILTALRDDL LYCQFNGRNM EELRRQYRLS QPQIYQIIAR QRKLHTRRHQ PDLFSPETPK. It is sometimes possible for the material contained within the vial of "Positive regulator of late transcription (C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
