Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative P2Y purinoceptor 10 (P2RY10) Recombinant Protein | P2RY10 recombinant protein

Recombinant Human Putative P2Y purinoceptor 10 (P2RY10)

Gene Names
P2RY10; P2Y10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative P2Y purinoceptor 10 (P2RY10); Recombinant Human Putative P2Y purinoceptor 10 (P2RY10); Recombinant Putative P2Y purinoceptor 10 (P2RY10); Putative P2Y purinoceptor 10; P2Y10; P2Y-like receptor; P2RY10 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-339
Sequence
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Sequence Length
339
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,774 Da
NCBI Official Full Name
putative P2Y purinoceptor 10
NCBI Official Synonym Full Names
purinergic receptor P2Y, G-protein coupled, 10
NCBI Official Symbol
P2RY10
NCBI Official Synonym Symbols
P2Y10
NCBI Protein Information
putative P2Y purinoceptor 10; P2Y-like receptor; G-protein coupled purinergic receptor P2Y10
UniProt Protein Name
Putative P2Y purinoceptor 10
Protein Family
UniProt Gene Name
P2RY10
UniProt Synonym Gene Names
P2Y10
UniProt Entry Name
P2Y10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. Two alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

P2RY10: Putative receptor for purines coupled to G-proteins. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: purinergic nucleotide receptor activity, G-protein coupled

Research Articles on P2RY10

Similar Products

Product Notes

The P2RY10 p2ry10 (Catalog #AAA1025412) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-339. The amino acid sequence is listed below: MANLDKYTET FKMGSNSTST AEIYCNVTNV KFQYSLYATT YILIFIPGLL ANSAALWVLC RFISKKNKAI IFMINLSVAD LAHVLSLPLR IYYYISHHWP FQRALCLLCF YLKYLNMYAS ICFLTCISLQ RCFFLLKPFR ARDWKRRYDV GISAAIWIVV GTACLPFPIL RSTDLNNNKS CFADLGYKQM NAVALVGMIT VAELAGFVIP VIIIAWCTWK TTISLRQPPM AFQGISERQK ALRMVFMCAA VFFICFTPYH INFIFYTMVK ETIISSCPVV RIALYFHPFC LCLASLCCLL DPILYYFMAS EFRDQLSRHG SSVTRSRLMS KESGSSMIG. It is sometimes possible for the material contained within the vial of "Putative P2Y purinoceptor 10 (P2RY10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.