Homeotic protein bicoid (bcd) Recombinant Protein | bcd recombinant protein
Recombinant Drosophila melanogaster Homeotic protein bicoid (bcd)
Gene Names
bcd; Bcd; BCD; BG:DS00276.7; bic; Bicoid; CG1034; DmelCG1034; mum; prd4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeotic protein bicoid (bcd); Recombinant Drosophila melanogaster Homeotic protein bicoid (bcd); bcd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-494, Full length protein
Sequence
MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN
Sequence Length
494
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,893 Da
NCBI Official Full Name
bicoid, isoform A
NCBI Official Synonym Full Names
bicoid
NCBI Official Symbol
bcd
NCBI Official Synonym Symbols
Bcd; BCD; BG:DS00276.7; bic; Bicoid; CG1034; DmelCG1034; mum; prd4
NCBI Protein Information
CG1034 gene product from transcript CG1034-RA
UniProt Protein Name
Homeotic protein bicoid
Protein Family
UniProt Gene Name
bcd
Uniprot Description
Segment polarity protein that provides positional cues for the development of head and thoracic segments. Regulates the expression of zygotic genes, possibly through its homeodomain, and inhibits the activity of other maternal gene products. May also bind RNA. Interacts with Bin1 to repress transcription of bicoid target genes in the anterior tip of the embryo; a process known as retraction.
Research Articles on bcd
Similar Products
Product Notes
The bcd bcd (Catalog #AAA1021579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-494, Full length protein. The amino acid sequence is listed below: MAQPPPDQNF YHHPLPHTHT HPHPHSHPHP HSHPHPHHQH PQLQLPPQFR NPFDLLFDER TGAINYNYIR PYLPNQMPKP DVFPSEELPD SLVMRRPRRT RTTFTSSQIA ELEQHFLQGR YLTAPRLADL SAKLALGTAQ VKIWFKNRRR RHKIQSDQHK DQSYEGMPLS PGMKQSDGDP PSLQTLSLGG GATPNALTPS PTPSTPTAHM TEHYSESFNA YYNYNGGHNH AQANRHMHMQ YPSGGGPGPG STNVNGGQFF QQQQVHNHQQ QLHHQGNHVP HQMQQQQQQA QQQQYHHFDF QQKQASACRV LVKDEPEADY NFNSSYYMRS GMSGATASAS AVARGAASPG SEVYEPLTPK NDESPSLCGI GIGGPCAIAV GETEAADDMD DGTSKKTTLQ ILEPLKGLDK SCDDGSSDDM STGIRALAGT GNRGAAFAKF GKPSPPQGPQ PPLGMGGVAM GESNQYQCTM DTIMQAYNPH RNAAGNSQFA YCFN. It is sometimes possible for the material contained within the vial of "Homeotic protein bicoid (bcd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
