Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (USP9Y) Recombinant Protein | USP9Y recombinant protein

Recombinant Human Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (USP9Y) , partial

Cat. Num. AAA1014952

• Gene Names: USP9Y; DFFRY; SPGFY2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (USP9Y); Recombinant Human Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (USP9Y); partial; USP9Y recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 3-91; Partial.
• Sequence: AITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVLP
• Sequence Length: 91

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for USP9Y recombinant protein

This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins.

NCBI and Uniprot Product Information

• NCBI GI #: 74319833
• NCBI GeneID: 8287
• NCBI Accession #: NP_004645.2
• NCBI GenBank Nucleotide #: NM_004654.3
• UniProt Accession #: O00507; O14601
• Molecular Weight: 235,723 Da
• NCBI Official Full Name: probable ubiquitin carboxyl-terminal hydrolase FAF-Y
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 9, Y-linked
• NCBI Official Symbol: USP9Y
• NCBI Official Synonym Symbols: DFFRY; SPGFY2
• NCBI Protein Information: probable ubiquitin carboxyl-terminal hydrolase FAF-Y
• UniProt Protein Name: Probable ubiquitin carboxyl-terminal hydrolase FAF-Y
• Protein Family: Probable ubiquitin carboxyl-terminal hydrolase
• UniProt Gene Name: USP9Y
• UniProt Synonym Gene Names: DFFRY

NCBI Description

This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. [provided by RefSeq, Mar 2009]

Uniprot Description

May function as a ubiquitin-protein or polyubiquitin hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade. Deubiquitination of SMAD4 by USP9X re-empowers its competence to mediate TGF-beta signaling ().