Sulfurtransferase TusD (tusD) Recombinant Protein | tusD recombinant protein
Recombinant Escherichia coli Sulfurtransferase TusD (tusD)
Gene Names
tusD; ECK3332; JW3307; yheN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfurtransferase TusD (tusD); Recombinant Escherichia coli Sulfurtransferase TusD (tusD); tusD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-128, full length protein
Sequence
MRFAIVVTGPAYGTQQASSAFQFAQALIADGHELSSVFFYREGVYNANQLTSPASDEFDLVRAWQQLNAQHGVALNICVAAALRRGVVDETEAGRLGLASSNLQQGFTLSGLGALAEASLTCDRVVQF
Sequence Length
128
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,641 Da
NCBI Official Full Name
sulfurtransferase for 2-thiolation step of mnm(5)-s(2)U34-tRNA synthesis
NCBI Official Symbol
tusD
NCBI Official Synonym Symbols
ECK3332; JW3307; yheN
NCBI Protein Information
sulfurtransferase for 2-thiolation step of mnm(5)-s(2)U34-tRNA synthesis
UniProt Protein Name
Sulfurtransferase TusD
Protein Family
UniProt Gene Name
tusD
UniProt Synonym Gene Names
yheN
NCBI Description
In YheLMN(TusBCD) complex, which mediates sulfur transfer from SirA(TusA) to YheLMN(TusBCD) binding partner YccK(TusE). [More information is available at EcoGene: EG12898]. TusD is labeled by 35S sulfur during 2-thiouridine formation in vitro. [More information is available at EcoCyc: G7714].
Uniprot Description
Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm5s2U) at tRNA wobble positions. Accepts sulfur from TusA and transfers it in turn to TusE.
Research Articles on tusD
Similar Products
Product Notes
The tusD tusd (Catalog #AAA1014477) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-128, full length protein. The amino acid sequence is listed below: MRFAIVVTGP AYGTQQASSA FQFAQALIAD GHELSSVFFY REGVYNANQL TSPASDEFDL VRAWQQLNAQ HGVALNICVA AALRRGVVDE TEAGRLGLAS SNLQQGFTLS GLGALAEASL TCDRVVQF. It is sometimes possible for the material contained within the vial of "Sulfurtransferase TusD (tusD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
