Large proline-rich protein bag6 (Bag6) Recombinant Protein | Bag6 recombinant protein

Recombinant Xenopus tropicalis Large proline-rich protein bag6 (Bag6), partial

Cat. Num. AAA1010708

• Gene Names: bag6; bat3; Bat-3; bag-6; Scythe; bag6-a; bag6-b; d6s52e
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Large proline-rich protein bag6 (Bag6); Recombinant Xenopus tropicalis Large proline-rich protein bag6 (Bag6); partial; Bag6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 930-1129. Partial.
• Sequence: GEIQRHIRRVGDVPQAPEASSQDQPMETTPVDCQNGAASPVPATTVEEVLFLPPQSSVPTICTDSEHPTQEDTGSEQWAASVPPEWVPVIRQDMQNQRKMKQQPPLSDAYLSGMPAKRRKTMQGEGPHLSLSEAVSRAMKATGAKPESSTDCVRRELDNSEAQGRYREQLCQDIQNILQDNESYSAQRFPNTQRAFRGDP
• Sequence Length: 1129

• Species: Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 350276201
• NCBI GeneID: 100038304
• NCBI Accession #: NP_001090878.2
• NCBI GenBank Nucleotide #: NM_001097409.2
• UniProt Accession #: A4IH17
• Molecular Weight: 120,785 Da
• NCBI Official Full Name: large proline-rich protein bag6 isoform 1
• NCBI Official Synonym Full Names: BCL2 associated athanogene 6
• NCBI Official Symbol: bag6
• NCBI Official Synonym Symbols: bat3; Bat-3; bag-6; Scythe; bag6-a; bag6-b; d6s52e
• NCBI Protein Information: large proline-rich protein bag6
• UniProt Protein Name: Large proline-rich protein bag6
• Protein Family: Large proline-rich protein
• UniProt Gene Name: Bag6

Uniprot Description

ATP-independent molecular chaperone preventing the aggregation of misfolded and hydrophobic patches-containing proteins. Functions as part of a cytosolic protein quality control complex, the bag6/bat3 complex, which maintains these client proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The bag6/bat3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Similarly, the bag6/bat3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The bag6/bat3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome. Also required for selective ubiquitin-mediated degradation of defective nascent chain polypeptides by the proteasome. Also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. May ensure the proper degradation of these proteins and thereby protects the endoplasmic reticulum from protein overload upon stress. By stabilizing a large spectrum of proteins, may indirectly affect different biological processes including apoptosis.